NBP257284PE
Novus Biologicals™ ROD1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257284PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257284PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
9991
Common Name
ROD1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PTBP3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51573. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROD1
- Source: E.coli Amino Acid Sequence: PAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPGASGIPGN The ROD1 Recombinant Protein Antigen is derived from E
- coli
- The ROD1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 9991
Common Name: ROD1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PTBP3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51573. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9991
Common Name:
ROD1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PTBP3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51573. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7013
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: NIMA-interacting protein 2, PIN2hTRF1-AS, Telomeric protein Pin2/TRF1, telomeric repeat binding factor (NIMA-interacting) 1, telomeric repeat binding factor 1, telomeric repeat binding protein 1, telomeric repeat-binding factor 1, TERF1, TRBF1, TRF1FLJ41416, TRFt-TRF1, TTAGGG repeat-binding factor 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7013
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
NIMA-interacting protein 2, PIN2hTRF1-AS, Telomeric protein Pin2/TRF1, telomeric repeat binding factor (NIMA-interacting) 1, telomeric repeat binding factor 1, telomeric repeat binding protein 1, telomeric repeat-binding factor 1, TERF1, TRBF1, TRF1FLJ41416, TRFt-TRF1, TTAGGG repeat-binding factor 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 7013
Common Name: TRF-1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: NIMA-interacting protein 2, PIN2hTRF1-AS, Telomeric protein Pin2/TRF1, telomeric repeat binding factor (NIMA-interacting) 1, telomeric repeat binding factor 1, telomeric repeat binding protein 1, telomeric repeat-binding factor 1, TERF1, TRBF1, TRF1FLJ414
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TERF1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51574. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7013
Common Name:
TRF-1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
NIMA-interacting protein 2, PIN2hTRF1-AS, Telomeric protein Pin2/TRF1, telomeric repeat binding factor (NIMA-interacting) 1, telomeric repeat binding factor 1, telomeric repeat binding protein 1, telomeric repeat-binding factor 1, TERF1, TRBF1, TRF1FLJ414
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TERF1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51574. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3594
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CD212, CD212 antigen, IL-12 receptor beta component, IL-12 receptor subunit beta-1, IL12R, IL-12R subunit beta-1, IL12RB, IL-12RB1, IL-12R-beta-1, IL-12R-BETA1, interleukin 12 receptor, beta 1, interleukin-12 receptor beta-1 chain, interleukin-12 receptor subunit beta-1, MGC34454
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3594
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CD212, CD212 antigen, IL-12 receptor beta component, IL-12 receptor subunit beta-1, IL12R, IL-12R subunit beta-1, IL12RB, IL-12RB1, IL-12R-beta-1, IL-12R-BETA1, interleukin 12 receptor, beta 1, interleukin-12 receptor beta-1 chain, interleukin-12 receptor subunit beta-1, MGC34454
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__