NBP257288PE
Novus Biologicals™ alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257288PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257288PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
147
Common Name
alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
ADRA1, adrenergic, alpha-1B-, receptor, alpha-1B adrenergic receptor, Alpha-1B adrenoceptor, Alpha-1B adrenoreceptor, alpha-1B-adrenergic receptor, ALPHA1BAR
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ADRA1B
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53485. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human alpha-1B Adrenergic R/ADRA1B
- Source: E.coli Amino Acid Sequence: MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG The alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen is derived from E
- coli
- The alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 147
Common Name: alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ADRA1, adrenergic, alpha-1B-, receptor, alpha-1B adrenergic receptor, Alpha-1B adrenoceptor, Alpha-1B adrenoreceptor, alpha-1B-adrenergic receptor, ALPHA1BAR
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ADRA1B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53485. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
147
Common Name:
alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ADRA1, adrenergic, alpha-1B-, receptor, alpha-1B adrenergic receptor, Alpha-1B adrenoceptor, Alpha-1B adrenoreceptor, alpha-1B-adrenergic receptor, ALPHA1BAR
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ADRA1B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53485. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7319
Common Name: HR6A/UBE2A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 6.3.2.19, hHR6A, HR6A, RAD6ARAD6 homolog A, UBC2, Ubiquitin carrier protein A, ubiquitin-conjugating enzyme E2 A, ubiquitin-conjugating enzyme E2A (RAD6 homolog), Ubiquitin-protein ligase A
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: UBE2A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50989. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7319
Common Name:
HR6A/UBE2A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 6.3.2.19, hHR6A, HR6A, RAD6ARAD6 homolog A, UBC2, Ubiquitin carrier protein A, ubiquitin-conjugating enzyme E2 A, ubiquitin-conjugating enzyme E2A (RAD6 homolog), Ubiquitin-protein ligase A
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
UBE2A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50989. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8814
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CDC2-related kinase 1, cyclin-dependent kinase-like 1, cyclin-dependent kinase-like 1 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIALRE, P42, Protein kinase p42 KKIALRE, serine/threonine protein kinase KKIALRE, Serine/threonine-protein kinase KKIALRE
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8814
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CDC2-related kinase 1, cyclin-dependent kinase-like 1, cyclin-dependent kinase-like 1 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIALRE, P42, Protein kinase p42 KKIALRE, serine/threonine protein kinase KKIALRE, Serine/threonine-protein kinase KKIALRE
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8814
Common Name: CDKL1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CDC2-related kinase 1, cyclin-dependent kinase-like 1, cyclin-dependent kinase-like 1 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIALRE, P42, Protein kinase p42 KKIALRE, serine/threonine protein kinase KKIALRE, Serine/threonine-protein kinase KKIALR
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CDKL1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52913. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8814
Common Name:
CDKL1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CDC2-related kinase 1, cyclin-dependent kinase-like 1, cyclin-dependent kinase-like 1 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIALRE, P42, Protein kinase p42 KKIALRE, serine/threonine protein kinase KKIALRE, Serine/threonine-protein kinase KKIALR
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CDKL1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52913. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml