NBP257312PE
Novus Biologicals™ ORAOV1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257312PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257312PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
220064
Common Name
ORAOV1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
oral cancer overexpressed 1, TAOS1oral cancer overexpressed protein 1-A, Tumor-amplified and overexpressed sequence 1
Label Type
Unlabeled
Quantity
100μL
Research Category
Cancer
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52612. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ORAOV1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ORAOV1
- Source: E.coli Amino Acid Sequence: GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF The ORAOV1 Recombinant Protein Antigen is derived from E
- coli
- The ORAOV1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 220064
Common Name: ORAOV1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: oral cancer overexpressed 1, TAOS1oral cancer overexpressed protein 1-A, Tumor-amplified and overexpressed sequence 1
Label Type: Unlabeled
Quantity: 100μL
Research Category: Cancer
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52612. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ORAOV1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
220064
Common Name:
ORAOV1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
oral cancer overexpressed 1, TAOS1oral cancer overexpressed protein 1-A, Tumor-amplified and overexpressed sequence 1
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Cancer
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52612. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ORAOV1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 60625
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C20orf15, DDX35, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 35, DEAH (Asp-Glu-Ala-His) box polypeptide 35, DEAH box protein 35, DEAH-box protein 35, EC 3.6.1, EC 3.6.4.13, FLJ22759, KAIA0875, probable ATP-dependent RNA helicase DHX35
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
60625
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C20orf15, DDX35, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 35, DEAH (Asp-Glu-Ala-His) box polypeptide 35, DEAH box protein 35, DEAH-box protein 35, EC 3.6.1, EC 3.6.4.13, FLJ22759, KAIA0875, probable ATP-dependent RNA helicase DHX35
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 162514
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: transient receptor potential cation channel subfamily V member 3, transient receptor potential cation channel, subfamily V, member 3, TrpV3, vanilloid receptor 3, Vanilloid receptor-like 3, vanilloid receptor-related osmotically activated channel protein, VRL3, VRL-3
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
162514
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
transient receptor potential cation channel subfamily V member 3, transient receptor potential cation channel, subfamily V, member 3, TrpV3, vanilloid receptor 3, Vanilloid receptor-like 3, vanilloid receptor-related osmotically activated channel protein, VRL3, VRL-3
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 162514
Common Name: Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: transient receptor potential cation channel subfamily V member 3, transient receptor potential cation channel, subfamily V, member 3, TrpV3, vanilloid receptor 3, Vanilloid receptor-like 3, vanilloid receptor-related osmotically activated channel protein,
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50774. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TRPV3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
162514
Common Name:
Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
transient receptor potential cation channel subfamily V member 3, transient receptor potential cation channel, subfamily V, member 3, TrpV3, vanilloid receptor 3, Vanilloid receptor-like 3, vanilloid receptor-related osmotically activated channel protein,
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50774. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TRPV3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli