NBP257349PE
Novus Biologicals™ Cyclin F Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257349PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257349PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
899
Common Name
Cyclin F Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
cyclin F, cyclin-F, FBX1FBXO1F-box only protein 1, G2/mitotic-specific cyclin-F
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CCNF
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53300. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cyclin F
- Source: E.coli Amino Acid Sequence: GDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVR The Cyclin F Recombinant Protein Antigen is derived from E
- coli
- The Cyclin F Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 899
Common Name: Cyclin F Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: cyclin F, cyclin-F, FBX1FBXO1F-box only protein 1, G2/mitotic-specific cyclin-F
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CCNF
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53300. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
899
Common Name:
Cyclin F Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
cyclin F, cyclin-F, FBX1FBXO1F-box only protein 1, G2/mitotic-specific cyclin-F
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CCNF
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53300. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8613
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Dri42, EC 3.1.3.4, lipid phosphate phosphohydrolase 3, LPP3PAP2 beta, MGC15306, PAP2b, PAP-2b, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, phosphatidic acid phosphatase type 2B, type-2 phosphatidic acid phosphatase-beta, vascular endothelial growth factor and type I collagen inducible, Vascular endothelial growth factor and type I collagen-inducible protein, VCIP
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8613
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Dri42, EC 3.1.3.4, lipid phosphate phosphohydrolase 3, LPP3PAP2 beta, MGC15306, PAP2b, PAP-2b, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, phosphatidic acid phosphatase type 2B, type-2 phosphatidic acid phosphatase-beta, vascular endothelial growth factor and type I collagen inducible, Vascular endothelial growth factor and type I collagen-inducible protein, VCIP
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 57798
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FLJ22489, GATA zinc finger domain containing 1, GATA zinc finger domain-containing protein 1, ocular development associated, Ocular development-associated gene protein, ODAGFLJ40695, RG083M05.2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
57798
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FLJ22489, GATA zinc finger domain containing 1, GATA zinc finger domain-containing protein 1, ocular development associated, Ocular development-associated gene protein, ODAGFLJ40695, RG083M05.2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 56413
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BLT2LTB4 receptor JULF2, BLT2R, BLTR2LTB4-R2, JULF2, KPG_004, leukotriene B4 receptor 2, Leukotriene B4 receptor BLT2, LTB4-R 2, NOP9, Seven transmembrane receptor BLTR2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
56413
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
BLT2LTB4 receptor JULF2, BLT2R, BLTR2LTB4-R2, JULF2, KPG_004, leukotriene B4 receptor 2, Leukotriene B4 receptor BLT2, LTB4-R 2, NOP9, Seven transmembrane receptor BLTR2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__