NBP257393PE
Novus Biologicals™ JAMP Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257393PE-Each-of-1 | In Stock | ₹ 31,372.50 |
NBP257393PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 31,372.50
GST (18%): ₹ 5,647.05
Total Price: ₹ 37,019.55
Gene ID (Entrez)
51528
Common Name
JAMP Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma a
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
JKAMP
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JAMP
- Source: E.coli Amino Acid Sequence: TFRRPMAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD The JAMP Recombinant Protein Antigen is derived from E
- coli
- The JAMP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51528
Common Name: JAMP Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma a
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: JKAMP
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51528
Common Name:
JAMP Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma a
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
JKAMP
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 83852
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8, Lysine N-methyltransferase 1F, SET domain bifurcated 2, SET domain, bifurcated 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
83852
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8, Lysine N-methyltransferase 1F, SET domain bifurcated 2, SET domain, bifurcated 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 83852
Common Name: SETDB2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SETDB2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50871. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
83852
Common Name:
SETDB2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SETDB2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50871. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3707
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.1.127, inositol 14,5-trisphosphate 3-kinase BIP3K, inositol-trisphosphate 3-kinase B, InsP 3-kinase B, IP3 3-kinase B, IP3-3KB, IP3K B, IP3KB, IP3K-B, PIG37, proliferation-inducing protein 37
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3707
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 2.7.1.127, inositol 14,5-trisphosphate 3-kinase BIP3K, inositol-trisphosphate 3-kinase B, InsP 3-kinase B, IP3 3-kinase B, IP3-3KB, IP3K B, IP3KB, IP3K-B, PIG37, proliferation-inducing protein 37
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__