NBP257393PE
Novus Biologicals™ JAMP Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257393PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257393PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
51528
Common Name
JAMP Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma a
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
JKAMP
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JAMP
- Source: E.coli Amino Acid Sequence: TFRRPMAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD The JAMP Recombinant Protein Antigen is derived from E
- coli
- The JAMP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51528
Common Name: JAMP Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma a
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: JKAMP
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51528
Common Name:
JAMP Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C14orf100, chromosome 14 open reading frame 100, HSPC213, HSPC327, JAMPCDA06, JNK1/MAPK8-associated membrane protein, JNK1-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, Medulloblastoma a
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
JKAMP
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 83852
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8, Lysine N-methyltransferase 1F, SET domain bifurcated 2, SET domain, bifurcated 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
83852
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8, Lysine N-methyltransferase 1F, SET domain bifurcated 2, SET domain, bifurcated 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 83852
Common Name: SETDB2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SETDB2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50871. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
83852
Common Name:
SETDB2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C13orf4, chromosome 13 open reading frame 4, chronic lymphocytic leukemia deletion region 8, Chronic lymphocytic leukemia deletion region gene 8 protein, CLLD8DKFZp761J1217, DKFZp586I0123, EC 2.1.1.43, histone-lysine N-methyltransferase SETDB2, KMT1FCLLL8
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SETDB2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50871. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3707
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.1.127, inositol 14,5-trisphosphate 3-kinase BIP3K, inositol-trisphosphate 3-kinase B, InsP 3-kinase B, IP3 3-kinase B, IP3-3KB, IP3K B, IP3KB, IP3K-B, PIG37, proliferation-inducing protein 37
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3707
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 2.7.1.127, inositol 14,5-trisphosphate 3-kinase BIP3K, inositol-trisphosphate 3-kinase B, InsP 3-kinase B, IP3 3-kinase B, IP3-3KB, IP3K B, IP3KB, IP3K-B, PIG37, proliferation-inducing protein 37
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__