NBP257408PE
Novus Biologicals™ Magmas Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257408PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257408PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
51025
Common Name
Magmas Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
MAGMAS, mitochondria associated protein involved in granulocyte macrophage colonystimulating factor signal transduction, Mitochondria-associated granulocyte macrophage CSF-signaling molecule, mitochondrial import inner membrane translocase subunit TIM16,
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PAM16
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50982. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Magmas
- Source: E.coli Amino Acid Sequence: VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT The Magmas Recombinant Protein Antigen is derived from E
- coli
- The Magmas Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51025
Common Name: Magmas Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: MAGMAS, mitochondria associated protein involved in granulocyte macrophage colonystimulating factor signal transduction, Mitochondria-associated granulocyte macrophage CSF-signaling molecule, mitochondrial import inner membrane translocase subunit TIM16,
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PAM16
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50982. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51025
Common Name:
Magmas Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
MAGMAS, mitochondria associated protein involved in granulocyte macrophage colonystimulating factor signal transduction, Mitochondria-associated granulocyte macrophage CSF-signaling molecule, mitochondrial import inner membrane translocase subunit TIM16,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PAM16
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50982. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5308
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: all1-responsive gene 1, ALL1-responsive protein ARP1, ARP1MGC20144, Homeobox protein PITX2, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, paired-like homeodomain 2, Paired-like homeodomain transcription factor 2MGC111022, pituitary homeo box 2, pituitary homeobox 2, PTX2, RGSRIEG1Brx1, RIEG, RIEG bicoid-related homeobox transcription factor, rieg bicoid-related homeobox transcription factor 1, RS, solurshin
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
5308
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
all1-responsive gene 1, ALL1-responsive protein ARP1, ARP1MGC20144, Homeobox protein PITX2, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, paired-like homeodomain 2, Paired-like homeodomain transcription factor 2MGC111022, pituitary homeo box 2, pituitary homeobox 2, PTX2, RGSRIEG1Brx1, RIEG, RIEG bicoid-related homeobox transcription factor, rieg bicoid-related homeobox transcription factor 1, RS, solurshin
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10773
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: zinc finger and BTB domain containing 6, zinc finger and BTB domain-containing protein 6, Zinc finger protein 482ZIDZinc finger protein with interaction domain, ZNF482
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10773
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
zinc finger and BTB domain containing 6, zinc finger and BTB domain-containing protein 6, Zinc finger protein 482ZIDZinc finger protein with interaction domain, ZNF482
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 23344
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: E-Syt1, extended synaptotagmin-like protein 1, family with sequence similarity 62 (C2 domain containing), member A, KIAA0747FAM62A, MBC2extended synaptotagmin-1, Membrane-bound C2 domain-containing protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23344
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
E-Syt1, extended synaptotagmin-like protein 1, family with sequence similarity 62 (C2 domain containing), member A, KIAA0747FAM62A, MBC2extended synaptotagmin-1, Membrane-bound C2 domain-containing protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__