NBP257484PE
Novus Biologicals™ Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257484PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257484PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
23081
Common Name
Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
KDM4C
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C
- Source: E.coli Amino Acid Sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen is derived from E
- coli
- The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 23081
Common Name: Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: KDM4C
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
23081
Common Name:
Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
KDM4C
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9329
Common Name: GTF3C4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 2.3.1.48, FLJ21002, general transcription factor 3C 4, general transcription factor 3C polypeptide 4, general transcription factor IIIC, polypeptide 4 (90kD), general transcription factor IIIC, polypeptide 4, 90kDa, KAT12, TF3C-delta, TFIII90, TFIIIC 9
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GTF3C4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50798. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9329
Common Name:
GTF3C4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 2.3.1.48, FLJ21002, general transcription factor 3C 4, general transcription factor 3C polypeptide 4, general transcription factor IIIC, polypeptide 4 (90kD), general transcription factor IIIC, polypeptide 4, 90kDa, KAT12, TF3C-delta, TFIII90, TFIIIC 9
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GTF3C4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50798. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9019
Common Name: MPZL1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FLJ21047, immunoglobulin family transmembrane protein, MPZL1b, myelin protein zero-like 1, myelin protein zero-like protein 1, protein zero related, Protein zero-related, PZR1b, PZRb, PZRPZRa
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MPZL1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52680. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9019
Common Name:
MPZL1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FLJ21047, immunoglobulin family transmembrane protein, MPZL1b, myelin protein zero-like 1, myelin protein zero-like protein 1, protein zero related, Protein zero-related, PZR1b, PZRb, PZRPZRa
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MPZL1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52680. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 81572
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C20orf126p53 and DNA damage regulated 1, chromosome 20 open reading frame 126, dJ310O13.3, p53 and DNA-damage regulated 1, PDRGp53 and DNA damage-regulated protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
81572
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C20orf126p53 and DNA damage regulated 1, chromosome 20 open reading frame 126, dJ310O13.3, p53 and DNA-damage regulated 1, PDRGp53 and DNA damage-regulated protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__