NBP257532PE
Novus Biologicals™ RPP14 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257532PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257532PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
11102
Common Name
RPP14 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
EC 3.1.26.5, EC 4.2.1.-, FLJ31508, HsHTD2, P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase, ribonuclease P (14kD), ribonuclease P 14kDa subunit, ribonuclease P protein subunit p14, ribonuclease P/MRP 14kDa subunit
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
RPP14
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52970. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPP14
- Source: E.coli Amino Acid Sequence: VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL The RPP14 Recombinant Protein Antigen is derived from E
- coli
- The RPP14 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 11102
Common Name: RPP14 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: EC 3.1.26.5, EC 4.2.1.-, FLJ31508, HsHTD2, P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase, ribonuclease P (14kD), ribonuclease P 14kDa subunit, ribonuclease P protein subunit p14, ribonuclease P/MRP 14kDa subunit
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RPP14
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52970. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
11102
Common Name:
RPP14 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
EC 3.1.26.5, EC 4.2.1.-, FLJ31508, HsHTD2, P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase, ribonuclease P (14kD), ribonuclease P 14kDa subunit, ribonuclease P protein subunit p14, ribonuclease P/MRP 14kDa subunit
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RPP14
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52970. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 55756
Common Name: RC74 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CPSF2L, FLJ10871, INT9, integrator complex subunit 9, Protein related to CPSF subunits of 74 kDa, RC74, RC-74
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: INTS9
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50720. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55756
Common Name:
RC74 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CPSF2L, FLJ10871, INT9, integrator complex subunit 9, Protein related to CPSF subunits of 74 kDa, RC74, RC-74
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
INTS9
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50720. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2736
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: GLI family zinc finger 2, GLI-Kruppel family member GLI2, glioma-associated oncogene family zinc finger 2, HPE9tax helper protein 1, oncogene GLI2, Tax helper protein, tax helper protein 2, tax-responsive element-2 holding protein, tax-responsive element-25-bp sequence binding protein, THP, THP1, THP2, zinc finger protein GLI2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2736
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
GLI family zinc finger 2, GLI-Kruppel family member GLI2, glioma-associated oncogene family zinc finger 2, HPE9tax helper protein 1, oncogene GLI2, Tax helper protein, tax helper protein 2, tax-responsive element-2 holding protein, tax-responsive element-25-bp sequence binding protein, THP, THP1, THP2, zinc finger protein GLI2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 2736
Common Name: GLI-2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: GLI family zinc finger 2, GLI-Kruppel family member GLI2, glioma-associated oncogene family zinc finger 2, HPE9tax helper protein 1, oncogene GLI2, Tax helper protein, tax helper protein 2, tax-responsive element-2 holding protein, tax-responsive element-
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GLI2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53474. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2736
Common Name:
GLI-2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
GLI family zinc finger 2, GLI-Kruppel family member GLI2, glioma-associated oncogene family zinc finger 2, HPE9tax helper protein 1, oncogene GLI2, Tax helper protein, tax helper protein 2, tax-responsive element-2 holding protein, tax-responsive element-
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GLI2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53474. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml