NBP257536PE
Novus Biologicals™ PHOX2B Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257536PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257536PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
8929
Common Name
PHOX2B Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
NBPHOX, NBPhoxPhox2b, Neuroblastoma Phox, paired mesoderm homeobox 2b, paired mesoderm homeobox protein 2B, paired-like homeobox 2bNBLST2, PHOX2B homeodomain protein, PMX2Bneuroblastoma paired-type homeobox protein
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PHOX2B
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53475. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHOX2B
- Source: E.coli Amino Acid Sequence: GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN The PHOX2B Recombinant Protein Antigen is derived from E
- coli
- The PHOX2B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 8929
Common Name: PHOX2B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: NBPHOX, NBPhoxPhox2b, Neuroblastoma Phox, paired mesoderm homeobox 2b, paired mesoderm homeobox protein 2B, paired-like homeobox 2bNBLST2, PHOX2B homeodomain protein, PMX2Bneuroblastoma paired-type homeobox protein
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PHOX2B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53475. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8929
Common Name:
PHOX2B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
NBPHOX, NBPhoxPhox2b, Neuroblastoma Phox, paired mesoderm homeobox 2b, paired mesoderm homeobox protein 2B, paired-like homeobox 2bNBLST2, PHOX2B homeodomain protein, PMX2Bneuroblastoma paired-type homeobox protein
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PHOX2B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53475. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2968
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Basic transcription factor 2 52 kDa subunit, BTF2 p52, General transcription factor IIH polypeptide 4, general transcription factor IIH subunit 4, general transcription factor IIH, polypeptide 4 (52kD subunit), general transcription factor IIH, polypeptide 4, 52kDa, TFB2, TFIIH, TFIIH basal transcription factor complex p52 subunit
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2968
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Basic transcription factor 2 52 kDa subunit, BTF2 p52, General transcription factor IIH polypeptide 4, general transcription factor IIH subunit 4, general transcription factor IIH, polypeptide 4 (52kD subunit), general transcription factor IIH, polypeptide 4, 52kDa, TFB2, TFIIH, TFIIH basal transcription factor complex p52 subunit
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 84132
Common Name: USP42 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Deubiquitinating enzyme 42, EC 3.1.2.15, EC 3.4.19.12, FLJ12697, ubiquitin carboxyl-terminal hydrolase 42, ubiquitin specific peptidase 42, ubiquitin specific protease 42, ubiquitin thioesterase 42, Ubiquitin thiolesterase 42, Ubiquitin-specific-processin
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: USP42
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50651. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
84132
Common Name:
USP42 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Deubiquitinating enzyme 42, EC 3.1.2.15, EC 3.4.19.12, FLJ12697, ubiquitin carboxyl-terminal hydrolase 42, ubiquitin specific peptidase 42, ubiquitin specific protease 42, ubiquitin thioesterase 42, Ubiquitin thiolesterase 42, Ubiquitin-specific-processin
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
USP42
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50651. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1613
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DAP kinase 3, DAP-like kinase, death-associated protein kinase 3, dlk, EC 2.7.11, EC 2.7.11.1, ZIP, ZIP kinase isoform, ZIPKFLJ36473, ZIP-kinase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
1613
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DAP kinase 3, DAP-like kinase, death-associated protein kinase 3, dlk, EC 2.7.11, EC 2.7.11.1, ZIP, ZIP kinase isoform, ZIPKFLJ36473, ZIP-kinase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__