NBP257554PE
Novus Biologicals™ SMURF2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257554PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257554PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
64750
Common Name
SMURF2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
DKFZp686F0270, E3 ubiquitin ligase SMURF2, E3 ubiquitin-protein ligase SMURF2, EC 6.3.2, EC 6.3.2.-, hSMURF2, MGC138150, SMAD specific E3 ubiquitin protein ligase 2, SMAD ubiquitination regulatory factor 2, SMAD-specific E3 ubiquitin-protein ligase 2
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SMURF2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50865. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMURF2
- Source: E.coli Amino Acid Sequence: LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD The SMURF2 Recombinant Protein Antigen is derived from E
- coli
- The SMURF2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 64750
Common Name: SMURF2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: DKFZp686F0270, E3 ubiquitin ligase SMURF2, E3 ubiquitin-protein ligase SMURF2, EC 6.3.2, EC 6.3.2.-, hSMURF2, MGC138150, SMAD specific E3 ubiquitin protein ligase 2, SMAD ubiquitination regulatory factor 2, SMAD-specific E3 ubiquitin-protein ligase 2
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SMURF2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50865. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
64750
Common Name:
SMURF2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
DKFZp686F0270, E3 ubiquitin ligase SMURF2, E3 ubiquitin-protein ligase SMURF2, EC 6.3.2, EC 6.3.2.-, hSMURF2, MGC138150, SMAD specific E3 ubiquitin protein ligase 2, SMAD ubiquitination regulatory factor 2, SMAD-specific E3 ubiquitin-protein ligase 2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SMURF2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50865. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9732
Common Name: DOCK4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: dedicator of cytokinesis 4, dedicator of cytokinesis protein 4, KIAA0716FLJ34238, MGC134911, MGC134912
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DOCK4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53293. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9732
Common Name:
DOCK4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
dedicator of cytokinesis 4, dedicator of cytokinesis protein 4, KIAA0716FLJ34238, MGC134911, MGC134912
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DOCK4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53293. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2357
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2357
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 2357
Common Name: FPR1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FPR1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52515. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2357
Common Name:
FPR1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FPR1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52515. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml