NBP257582PE
Novus Biologicals™ LETMD1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257582PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257582PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
25875
Common Name
LETMD1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
1110019O13Rik, cervical cancer 1 protooncogene, Cervical cancer 1 proto-oncogene protein p40, Cervical cancer proto-oncogene 2 protein, DKFZp586A011, HCCR1, HCCR-1, HCCR-2, HCRR-2, LETM1 domain containing 1, LETM1 domain-containing protein 1, regulator of
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
LETMD1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53479. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LETMD1
- Source: E.coli Amino Acid Sequence: FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG The LETMD1 Recombinant Protein Antigen is derived from E
- coli
- The LETMD1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 25875
Common Name: LETMD1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: 1110019O13Rik, cervical cancer 1 protooncogene, Cervical cancer 1 proto-oncogene protein p40, Cervical cancer proto-oncogene 2 protein, DKFZp586A011, HCCR1, HCCR-1, HCCR-2, HCRR-2, LETM1 domain containing 1, LETM1 domain-containing protein 1, regulator of
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LETMD1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53479. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
25875
Common Name:
LETMD1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
1110019O13Rik, cervical cancer 1 protooncogene, Cervical cancer 1 proto-oncogene protein p40, Cervical cancer proto-oncogene 2 protein, DKFZp586A011, HCCR1, HCCR-1, HCCR-2, HCRR-2, LETM1 domain containing 1, LETM1 domain-containing protein 1, regulator of
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LETMD1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53479. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9372
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Madh-interacting protein, MADHIP, mothers against decapentaplegic homolog interacting protein, mothers against decapentaplegic homolog interacting protein, receptoractivation anchor, NSP, receptor activation anchor, SARAhSARA, Smad anchor for receptor activation, SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein, zinc finger FYVE domain-containing protein 9, zinc finger, FYVE domain containing 9
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
9372
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Madh-interacting protein, MADHIP, mothers against decapentaplegic homolog interacting protein, mothers against decapentaplegic homolog interacting protein, receptoractivation anchor, NSP, receptor activation anchor, SARAhSARA, Smad anchor for receptor activation, SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein, zinc finger FYVE domain-containing protein 9, zinc finger, FYVE domain containing 9
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 9372
Common Name: ZFYVE9 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Madh-interacting protein, MADHIP, mothers against decapentaplegic homolog interacting protein, mothers against decapentaplegic homolog interacting protein, receptoractivation anchor, NSP, receptor activation anchor, SARAhSARA, Smad anchor for receptor act
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ZFYVE9
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52909. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9372
Common Name:
ZFYVE9 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Madh-interacting protein, MADHIP, mothers against decapentaplegic homolog interacting protein, mothers against decapentaplegic homolog interacting protein, receptoractivation anchor, NSP, receptor activation anchor, SARAhSARA, Smad anchor for receptor act
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ZFYVE9
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52909. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 54957
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Dim1-like protein, Dim2, DLPthioredoxin-like protein 4B, FLJ20511, thioredoxin-like 4B
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
54957
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Dim1-like protein, Dim2, DLPthioredoxin-like protein 4B, FLJ20511, thioredoxin-like 4B
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__