NBP257600PE
Novus Biologicals™ Wnt-11 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257600PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257600PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
7481
Common Name
Wnt-11 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
HWNT11, MGC141946, MGC141948, protein Wnt-11, wingless-type MMTV integration site family, member 11
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
WNT11
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52688. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Wnt-11
- Source: E.coli Amino Acid Sequence: ATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCD The Wnt-11 Recombinant Protein Antigen is derived from E
- coli
- The Wnt-11 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 7481
Common Name: Wnt-11 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: HWNT11, MGC141946, MGC141948, protein Wnt-11, wingless-type MMTV integration site family, member 11
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: WNT11
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52688. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7481
Common Name:
Wnt-11 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
HWNT11, MGC141946, MGC141948, protein Wnt-11, wingless-type MMTV integration site family, member 11
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
WNT11
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52688. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 84957
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Receptor expressed in lymphoid tissues, RELT tumor necrosis factor receptor, TNFRSF19LFLJ14993, tumor necrosis factor receptor superfamily member 19L, tumor necrosis factor receptor superfamily, member 19-like
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
84957
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Receptor expressed in lymphoid tissues, RELT tumor necrosis factor receptor, TNFRSF19LFLJ14993, tumor necrosis factor receptor superfamily member 19L, tumor necrosis factor receptor superfamily, member 19-like
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 84957
Common Name: RELT/TNFRSF19L Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Receptor expressed in lymphoid tissues, RELT tumor necrosis factor receptor, TNFRSF19LFLJ14993, tumor necrosis factor receptor superfamily member 19L, tumor necrosis factor receptor superfamily, member 19-like
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RELT
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53294. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
84957
Common Name:
RELT/TNFRSF19L Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Receptor expressed in lymphoid tissues, RELT tumor necrosis factor receptor, TNFRSF19LFLJ14993, tumor necrosis factor receptor superfamily member 19L, tumor necrosis factor receptor superfamily, member 19-like
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RELT
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53294. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 27350
Common Name: APOBEC3C Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: APOBEC1LA3C, APOBEC1-like, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C, ARDC2, ARDC4, ARP5, bK150C2.3, EC 3.5.4.-, PBIMGC19485, Phorbolin I, probable DNA dC->dU-editing enzyme APOBEC-3C
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: APOBEC3C
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53295. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
27350
Common Name:
APOBEC3C Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
APOBEC1LA3C, APOBEC1-like, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C, ARDC2, ARDC4, ARP5, bK150C2.3, EC 3.5.4.-, PBIMGC19485, Phorbolin I, probable DNA dC->dU-editing enzyme APOBEC-3C
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
APOBEC3C
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53295. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml