NBP257623PE
Novus Biologicals™ HNF-3 beta/FoxA2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257623PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257623PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
3170
Common Name
HNF-3 beta/FoxA2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
FOXA2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52975. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNF-3 beta/FoxA2
- Source: E.coli Amino Acid Sequence: SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS The HNF-3 beta/FoxA2 Recombinant Protein Antigen is derived from E
- coli
- The HNF-3 beta/FoxA2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 3170
Common Name: HNF-3 beta/FoxA2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FOXA2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52975. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3170
Common Name:
HNF-3 beta/FoxA2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FOXA2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52975. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51065
Common Name: RPS27L Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: 40S ribosomal protein S27-like, ribosomal protein S27-like
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RPS27L
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50722. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51065
Common Name:
RPS27L Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
40S ribosomal protein S27-like, ribosomal protein S27-like
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RPS27L
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50722. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3140
Common Name: MR1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Class I histocompatibility antigen-like protein, FLJ31593, HLALS, major histocompatibility complex class I-related gene protein, major histocompatibility complex, class I-like sequence, major histocompatibility complex, class I-related, MHC class I-like a
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MR1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51571. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3140
Common Name:
MR1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Class I histocompatibility antigen-like protein, FLJ31593, HLALS, major histocompatibility complex class I-related gene protein, major histocompatibility complex, class I-like sequence, major histocompatibility complex, class I-related, MHC class I-like a
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MR1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51571. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10739
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: ret finger protein-like 2, RNF79RING finger protein 79
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10739
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
ret finger protein-like 2, RNF79RING finger protein 79
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__