NBP257643PE
Novus Biologicals™ MOBKL1B Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257643PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257643PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
55233
Common Name
MOBKL1B Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
C2orf6, chromosome 2 open reading frame 6, FLJ10788, FLJ11595, MATS1, MOB1, Mob1 alpha, Mob1 homolog 1B, MOB1, Mps One Binder kinase activator-like 1B (yeast), mob1A, Mob4B, MOBK1B, mps one binder kinase activator-like 1B, Protein Mob4B
Label Type
Unlabeled
Quantity
100μL
Research Category
Cancer
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50872. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MOB1A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MOBKL1B
- Source: E.coli Amino Acid Sequence: RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL The MOBKL1B Recombinant Protein Antigen is derived from E
- coli
- The MOBKL1B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 55233
Common Name: MOBKL1B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C2orf6, chromosome 2 open reading frame 6, FLJ10788, FLJ11595, MATS1, MOB1, Mob1 alpha, Mob1 homolog 1B, MOB1, Mps One Binder kinase activator-like 1B (yeast), mob1A, Mob4B, MOBK1B, mps one binder kinase activator-like 1B, Protein Mob4B
Label Type: Unlabeled
Quantity: 100μL
Research Category: Cancer
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50872. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MOB1A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
55233
Common Name:
MOBKL1B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C2orf6, chromosome 2 open reading frame 6, FLJ10788, FLJ11595, MATS1, MOB1, Mob1 alpha, Mob1 homolog 1B, MOB1, Mps One Binder kinase activator-like 1B (yeast), mob1A, Mob4B, MOBK1B, mps one binder kinase activator-like 1B, Protein Mob4B
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Cancer
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50872. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MOB1A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 401251
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C6orf26, Chromosome 6 Open Reading Frame 26, G7D, NG23, Protein G7d, Suppressor APC Domain Containing 1, Suppressor APC Domain-Containing Protein 1
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
401251
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C6orf26, Chromosome 6 Open Reading Frame 26, G7D, NG23, Protein G7d, Suppressor APC Domain Containing 1, Suppressor APC Domain-Containing Protein 1
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 401251
Common Name: SAPCD1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C6orf26, Chromosome 6 Open Reading Frame 26, G7D, NG23, Protein G7d, Suppressor APC Domain Containing 1, Suppressor APC Domain-Containing Protein 1
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53305. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SAPCD1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
401251
Common Name:
SAPCD1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C6orf26, Chromosome 6 Open Reading Frame 26, G7D, NG23, Protein G7d, Suppressor APC Domain Containing 1, Suppressor APC Domain-Containing Protein 1
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53305. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SAPCD1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 254863
Common Name: TMEM256 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C17orf61, Chromosome 17 Open Reading Frame 61, Transmembrane Protein 256, UPF0451 Protein C17orf61
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50537. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: THMEM256
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
254863
Common Name:
TMEM256 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C17orf61, Chromosome 17 Open Reading Frame 61, Transmembrane Protein 256, UPF0451 Protein C17orf61
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50537. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
THMEM256
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli