NBP257655PE
Novus Biologicals™ SYF2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257655PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257655PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
25949
Common Name
SYF2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
CBPIN, CCNDBP1 interactor, CCNDBP1-interactor, DKFZp564O2082, fSAP29, functional spliceosome-associated protein 29, GCIP-interacting protein p29, GCIPIP, NTC31, P29, pre-mRNA-splicing factor SYF2, SYF2 homolog, RNA splicing factor (S. cerevisiae)
Label Type
Unlabeled
Quantity
100μL
Research Category
Cell Cycle and Replication
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53235. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SYF2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYF2
- Source: E.coli Amino Acid Sequence: KRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV The SYF2 Recombinant Protein Antigen is derived from E
- coli
- The SYF2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 25949
Common Name: SYF2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CBPIN, CCNDBP1 interactor, CCNDBP1-interactor, DKFZp564O2082, fSAP29, functional spliceosome-associated protein 29, GCIP-interacting protein p29, GCIPIP, NTC31, P29, pre-mRNA-splicing factor SYF2, SYF2 homolog, RNA splicing factor (S. cerevisiae)
Label Type: Unlabeled
Quantity: 100μL
Research Category: Cell Cycle and Replication
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53235. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SYF2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
25949
Common Name:
SYF2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CBPIN, CCNDBP1 interactor, CCNDBP1-interactor, DKFZp564O2082, fSAP29, functional spliceosome-associated protein 29, GCIP-interacting protein p29, GCIPIP, NTC31, P29, pre-mRNA-splicing factor SYF2, SYF2 homolog, RNA splicing factor (S. cerevisiae)
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Cell Cycle and Replication
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53235. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SYF2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 58517
Common Name: RBM25 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Arg/Glu/Asp-rich protein of 120 kDa, Arg/Glu/Asp-rich protein, 120 kDa, fSAP94, functional spliceosome-associated protein 94, MGC105088, MGC117168, NET52, Protein S164, RED120RNA-binding region-containing protein 7, RNA binding motif protein 25, RNA-bindi
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53236. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RBM25
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
58517
Common Name:
RBM25 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Arg/Glu/Asp-rich protein of 120 kDa, Arg/Glu/Asp-rich protein, 120 kDa, fSAP94, functional spliceosome-associated protein 94, MGC105088, MGC117168, NET52, Protein S164, RED120RNA-binding region-containing protein 7, RNA binding motif protein 25, RNA-bindi
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53236. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RBM25
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 7508
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: complementation group C p125, RAD4, Xeroderma pigmentosum group C-complementing protein, xeroderma pigmentosum, complementation group C, XP3, XPCCDNA repair protein complementing XP-C cells
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
7508
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
complementation group C p125, RAD4, Xeroderma pigmentosum group C-complementing protein, xeroderma pigmentosum, complementation group C, XP3, XPCCDNA repair protein complementing XP-C cells
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 8940
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DNA topoisomerase 3-beta-1, DNA topoisomerase III beta-1, EC 5.99.1.2, FLJ39376, TOP3B1, topoisomerase (DNA) III beta, topoisomerase III beta
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
8940
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DNA topoisomerase 3-beta-1, DNA topoisomerase III beta-1, EC 5.99.1.2, FLJ39376, TOP3B1, topoisomerase (DNA) III beta, topoisomerase III beta
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__