NBP257689PE
Novus Biologicals™ LINGO-1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257689PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257689PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
84894
Common Name
LINGO-1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
FLJ14594, LERN1UNQ201, leucine rich repeat and Ig domain containing 1, leucine rich repeat neuronal 6A, Leucine-rich repeat and immunoglobilin domain-containing protein 1, Leucine-rich repeat neuronal protein 1, Leucine-rich repeat neuronal protein 6A, LR
Label Type
Unlabeled
Quantity
100μL
Research Category
Neuroscience
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53501. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
LINGO1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LINGO-1
- Source: E.coli Amino Acid Sequence: TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV The LINGO-1 Recombinant Protein Antigen is derived from E
- coli
- The LINGO-1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 84894
Common Name: LINGO-1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: FLJ14594, LERN1UNQ201, leucine rich repeat and Ig domain containing 1, leucine rich repeat neuronal 6A, Leucine-rich repeat and immunoglobilin domain-containing protein 1, Leucine-rich repeat neuronal protein 1, Leucine-rich repeat neuronal protein 6A, LR
Label Type: Unlabeled
Quantity: 100μL
Research Category: Neuroscience
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53501. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LINGO1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
84894
Common Name:
LINGO-1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
FLJ14594, LERN1UNQ201, leucine rich repeat and Ig domain containing 1, leucine rich repeat neuronal 6A, Leucine-rich repeat and immunoglobilin domain-containing protein 1, Leucine-rich repeat neuronal protein 1, Leucine-rich repeat neuronal protein 6A, LR
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Neuroscience
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53501. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LINGO1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 56138
Common Name: PCDHA11 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CNR7, CNRN7, CNRS7, CRNR7, KIAA0345-like 3, ortholog of mouse CNR7, PCDH-alpha-11, PCDH-ALPHA11, protocadherin alpha 11, protocadherin alpha-11
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53600. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PCDHA11
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
56138
Common Name:
PCDHA11 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CNR7, CNRN7, CNRS7, CRNR7, KIAA0345-like 3, ortholog of mouse CNR7, PCDH-alpha-11, PCDH-ALPHA11, protocadherin alpha 11, protocadherin alpha-11
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53600. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PCDHA11
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 130271
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: KIAA2028, pleckstrin homology domain containing, family H (with MyTH4 domain) member 2, PLEKHH1L
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
130271
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
KIAA2028, pleckstrin homology domain containing, family H (with MyTH4 domain) member 2, PLEKHH1L
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 130271
Common Name: PLEKHH2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: KIAA2028, pleckstrin homology domain containing, family H (with MyTH4 domain) member 2, PLEKHH1L
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53601. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PLEKHH2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
130271
Common Name:
PLEKHH2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
KIAA2028, pleckstrin homology domain containing, family H (with MyTH4 domain) member 2, PLEKHH1L
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53601. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PLEKHH2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli