NBP257726PE
Novus Biologicals™ SPATA33 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257726PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257726PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
124045
Common Name
C16orf55 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
chromosome 16 open reading frame 55, FLJ31606, hypothetical protein LOC124045
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
C16ORF55
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53386. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C16orf55
- Source: E.coli Amino Acid Sequence: SCSSSGSDQQRTIREPEDWGPYRRHRNPSTADAYNSHLKE The SPATA33 Recombinant Protein Antigen is derived from E
- coli
- The SPATA33 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 124045
Common Name: C16orf55 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: chromosome 16 open reading frame 55, FLJ31606, hypothetical protein LOC124045
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: C16ORF55
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53386. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
124045
Common Name:
C16orf55 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
chromosome 16 open reading frame 55, FLJ31606, hypothetical protein LOC124045
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
C16ORF55
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53386. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5588
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.11, EC 2.7.11.13, MGC126514, MGC141919, nPKC-theta, PRKCT, protein kinase C theta type, protein kinase C, theta
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
5588
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 2.7.11, EC 2.7.11.13, MGC126514, MGC141919, nPKC-theta, PRKCT, protein kinase C theta type, protein kinase C, theta
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 6532
Common Name: SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute ca
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLC6A4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53503. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6532
Common Name:
SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute ca
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SLC6A4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53503. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 58508
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: ALR-like protein, DKFZp686C08112, EC 2.1.1.43, FLJ12625, HALRMGC119851, histone-lysine N-methyltransferase MLL3, histone-lysine N-methyltransferase, H3 lysine-4 specific, Homologous to ALR protein, KIAA1506FLJ38309, KMT2C, KMT2CMGC119852, Lysine N-methyltransferase 2C, MGC119853, myeloid/lymphoid or mixed-lineage leukemia 3, Myeloid/lymphoid or mixed-lineage leukemia protein 3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
58508
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
ALR-like protein, DKFZp686C08112, EC 2.1.1.43, FLJ12625, HALRMGC119851, histone-lysine N-methyltransferase MLL3, histone-lysine N-methyltransferase, H3 lysine-4 specific, Homologous to ALR protein, KIAA1506FLJ38309, KMT2C, KMT2CMGC119852, Lysine N-methyltransferase 2C, MGC119853, myeloid/lymphoid or mixed-lineage leukemia 3, Myeloid/lymphoid or mixed-lineage leukemia protein 3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__