NBP257732PE
Novus Biologicals™ FAM132B Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257732PE-Each-of-1 | In Stock | ₹ 31,372.50 |
NBP257732PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 31,372.50
GST (18%): ₹ 5,647.05
Total Price: ₹ 37,019.55
Gene ID (Entrez)
151176
Common Name
FAM132B Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
FAM132B
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53602. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM132B
- Source: E.coli Amino Acid Sequence: EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP The FAM132B Recombinant Protein Antigen is derived from E
- coli
- The FAM132B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 151176
Common Name: FAM132B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FAM132B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53602. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
151176
Common Name:
FAM132B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FAM132B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53602. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 389856
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Deubiquitinating Enzyme 27, MRX105, Ubiquitin Carboxyl-Terminal Hydrolase 22-Like, Ubiquitin Carboxyl-Terminal Hydrolase 27, Ubiquitin Specific Peptidase 27, X-Linked, Ubiquitin Specific Protease 27, X Chromosome, Ubiquitin Specific Protease 27, X-Linked, Ubiquitin Thioesterase 27, Ubiquitin-Specific-Processing Protease 27, USP22L, USP27, X-Linked Ubiquitin Carboxyl-Terminal Hydrolase 27
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
389856
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Deubiquitinating Enzyme 27, MRX105, Ubiquitin Carboxyl-Terminal Hydrolase 22-Like, Ubiquitin Carboxyl-Terminal Hydrolase 27, Ubiquitin Specific Peptidase 27, X-Linked, Ubiquitin Specific Protease 27, X Chromosome, Ubiquitin Specific Protease 27, X-Linked, Ubiquitin Thioesterase 27, Ubiquitin-Specific-Processing Protease 27, USP22L, USP27, X-Linked Ubiquitin Carboxyl-Terminal Hydrolase 27
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 389856
Common Name: USP27X Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Deubiquitinating Enzyme 27, MRX105, Ubiquitin Carboxyl-Terminal Hydrolase 22-Like, Ubiquitin Carboxyl-Terminal Hydrolase 27, Ubiquitin Specific Peptidase 27, X-Linked, Ubiquitin Specific Protease 27, X Chromosome, Ubiquitin Specific Protease 27, X-Linked,
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: USP27X
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53603. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
389856
Common Name:
USP27X Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Deubiquitinating Enzyme 27, MRX105, Ubiquitin Carboxyl-Terminal Hydrolase 22-Like, Ubiquitin Carboxyl-Terminal Hydrolase 27, Ubiquitin Specific Peptidase 27, X-Linked, Ubiquitin Specific Protease 27, X Chromosome, Ubiquitin Specific Protease 27, X-Linked,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
USP27X
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53603. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 115908
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: collagen triple helix repeat containing 1, collagen triple helix repeat-containing protein 1, Protein NMTC1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
115908
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
collagen triple helix repeat containing 1, collagen triple helix repeat-containing protein 1, Protein NMTC1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__