NBP257756PE
Novus Biologicals™ FLI1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257756PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257756PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
2313
Common Name
FLI1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
FLI1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53388. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FLI1
- Source: E.coli Amino Acid Sequence: SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT The FLI1 Recombinant Protein Antigen is derived from E
- coli
- The FLI1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2313
Common Name: FLI1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FLI1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53388. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2313
Common Name:
FLI1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FLI1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53388. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2019
Common Name: EN1/Engrailed 1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: engrailed homeobox 1, engrailed homolog 1, Homeobox protein en-1, homeobox protein engrailed-1, hu-En-1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EN1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: Human
Gene ID (Entrez):
2019
Common Name:
EN1/Engrailed 1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
engrailed homeobox 1, engrailed homolog 1, Homeobox protein en-1, homeobox protein engrailed-1, hu-En-1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
EN1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
Human
Gene ID (Entrez): 1038
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CDR, CDR34, CDR62A, Cerebellar Degeneration Related Protein 1, Cerebellar Degeneration-Related Antigen 1, Cerebellar Degeneration-Related Protein (34kD), Cerebellar Degeneration-Related Protein 1, 34kDa, Cerebellar Degeneration-Related Protein-1 (34kD)
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
1038
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CDR, CDR34, CDR62A, Cerebellar Degeneration Related Protein 1, Cerebellar Degeneration-Related Antigen 1, Cerebellar Degeneration-Related Protein (34kD), Cerebellar Degeneration-Related Protein 1, 34kDa, Cerebellar Degeneration-Related Protein-1 (34kD)
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 1038
Common Name: CDR1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CDR, CDR34, CDR62A, Cerebellar Degeneration Related Protein 1, Cerebellar Degeneration-Related Antigen 1, Cerebellar Degeneration-Related Protein (34kD), Cerebellar Degeneration-Related Protein 1, 34kDa, Cerebellar Degeneration-Related Protein-1 (34kD)
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CDR1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53390. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1038
Common Name:
CDR1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CDR, CDR34, CDR62A, Cerebellar Degeneration Related Protein 1, Cerebellar Degeneration-Related Antigen 1, Cerebellar Degeneration-Related Protein (34kD), Cerebellar Degeneration-Related Protein 1, 34kDa, Cerebellar Degeneration-Related Protein-1 (34kD)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CDR1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53390. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml