NBP257763PE
Novus Biologicals™ UCP4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257763PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257763PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
9481
Common Name
UCP4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
FLJ33552, mitochondrial uncoupling protein 4, Solute carrier family 25 member 27, solute carrier family 25, member 27, UCP 4, UCP4uncoupling protein 4
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SLC25A27
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53174. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UCP4
- Source: E.coli Amino Acid Sequence: MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL The UCP4 Recombinant Protein Antigen is derived from E
- coli
- The UCP4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 9481
Common Name: UCP4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: FLJ33552, mitochondrial uncoupling protein 4, Solute carrier family 25 member 27, solute carrier family 25, member 27, UCP 4, UCP4uncoupling protein 4
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLC25A27
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53174. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9481
Common Name:
UCP4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
FLJ33552, mitochondrial uncoupling protein 4, Solute carrier family 25 member 27, solute carrier family 25, member 27, UCP 4, UCP4uncoupling protein 4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SLC25A27
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53174. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 284904
Common Name: SEC14L4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: dJ130H16.5, SEC14-like 4 (S. cerevisiae), SEC14p-like protein TAP3, TAP3SEC14-like protein 4, Tocopherol-associated protein 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SEC14L4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53175. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
284904
Common Name:
SEC14L4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
dJ130H16.5, SEC14-like 4 (S. cerevisiae), SEC14p-like protein TAP3, TAP3SEC14-like protein 4, Tocopherol-associated protein 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SEC14L4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53175. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1801
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
1801
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 1801
Common Name: OVCA1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynt
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DPH1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53176. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1801
Common Name:
OVCA1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynt
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DPH1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53176. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml