NBP257782PE
Novus Biologicals™ Lhx8 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257782PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257782PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
431707
Common Name
Lhx8 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
LIM homeobox 8, LIM homeobox protein 8
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
LHX8
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50877. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lhx8
- Source: E.coli Amino Acid Sequence: LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT The Lhx8 Recombinant Protein Antigen is derived from E
- coli
- The Lhx8 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 431707
Common Name: Lhx8 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: LIM homeobox 8, LIM homeobox protein 8
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LHX8
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50877. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
431707
Common Name:
Lhx8 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
LIM homeobox 8, LIM homeobox protein 8
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LHX8
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50877. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9519
Common Name: TBP like protein TLP Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: 21 kDa TBP-like protein, STUD21-kDA TBP-like protein, TATA box binding protein-related factor 2, TATA box-binding protein-like protein 1, TATA box-binding protein-related factor 2, TBP-like 1, TBP-like factor, TBP-like protein 1, TBP-related factor 2, TBP
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TBPL1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53312. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9519
Common Name:
TBP like protein TLP Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
21 kDa TBP-like protein, STUD21-kDA TBP-like protein, TATA box binding protein-related factor 2, TATA box-binding protein-like protein 1, TATA box-binding protein-related factor 2, TBP-like 1, TBP-like factor, TBP-like protein 1, TBP-related factor 2, TBP
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TBPL1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53312. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9254
Common Name: CACNA2D2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: alpha 2 delta calcium channel subunit, CACNA2D, calcium channel, voltage-dependent, alpha 2/delta subunit 2, gene 26, KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2, LUAC11.1, voltage-dependent calcium channel subunit alpha-2/delta-2
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CACNA2D2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53313. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9254
Common Name:
CACNA2D2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
alpha 2 delta calcium channel subunit, CACNA2D, calcium channel, voltage-dependent, alpha 2/delta subunit 2, gene 26, KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2, LUAC11.1, voltage-dependent calcium channel subunit alpha-2/delta-2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CACNA2D2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53313. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9441
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
9441
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__