NBP257804PE
Novus Biologicals™ epsilon-Sarcoglycan Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257804PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257804PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
8910
Common Name
SGCE Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
dystonia 11, myoclonic, DYT11, epsilon-sarcoglycan, Epsilon-SG, ESG, sarcoglycan, epsilon
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SGCE
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50923. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SGCE
- Source: E.coli Amino Acid Sequence: DIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGKWY The epsilon-Sarcoglycan Recombinant Protein Antigen is derived from E
- coli
- The epsilon-Sarcoglycan Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 8910
Common Name: SGCE Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: dystonia 11, myoclonic, DYT11, epsilon-sarcoglycan, Epsilon-SG, ESG, sarcoglycan, epsilon
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SGCE
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50923. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8910
Common Name:
SGCE Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
dystonia 11, myoclonic, DYT11, epsilon-sarcoglycan, Epsilon-SG, ESG, sarcoglycan, epsilon
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SGCE
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50923. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7702
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: hStaf, SBFzinc finger protein 143 (clone pHZ-1), Selenocysteine tRNA gene transcription-activating factor, SPH-binding factor, STAFpHZ-1, transcriptional activator Staf, zinc finger protein 143
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7702
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
hStaf, SBFzinc finger protein 143 (clone pHZ-1), Selenocysteine tRNA gene transcription-activating factor, SPH-binding factor, STAFpHZ-1, transcriptional activator Staf, zinc finger protein 143
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 7702
Common Name: ZNF143 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: hStaf, SBFzinc finger protein 143 (clone pHZ-1), Selenocysteine tRNA gene transcription-activating factor, SPH-binding factor, STAFpHZ-1, transcriptional activator Staf, zinc finger protein 143
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ZNF143
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53508. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7702
Common Name:
ZNF143 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
hStaf, SBFzinc finger protein 143 (clone pHZ-1), Selenocysteine tRNA gene transcription-activating factor, SPH-binding factor, STAFpHZ-1, transcriptional activator Staf, zinc finger protein 143
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ZNF143
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53508. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8322
Common Name: Frizzled-4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CD344, CD344 antigen, EVR1, exudative vitreoretinopathy 1, FEVR, frizzled (Drosophila) homolog 4, frizzled homolog 4 (Drosophila), frizzled-4, Fz-4, FZD4S, FzE4, GPCR, hFz4, MGC34390, WNT receptor frizzled-4
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FZD4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50924. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8322
Common Name:
Frizzled-4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CD344, CD344 antigen, EVR1, exudative vitreoretinopathy 1, FEVR, frizzled (Drosophila) homolog 4, frizzled homolog 4 (Drosophila), frizzled-4, Fz-4, FZD4S, FzE4, GPCR, hFz4, MGC34390, WNT receptor frizzled-4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FZD4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50924. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml