NBP257820PE
Novus Biologicals™ MAGEA10 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257820PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257820PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4109
Common Name
MAGEA10 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
Cancer/testis antigen 1.10, CT1.10member 10, MAGE-10 antigen, melanoma antigen family A, 10, melanoma-associated antigen 10
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MAGEA10
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53241. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAGEA10
- Source: E.coli Amino Acid Sequence: MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTST The MAGEA10 Recombinant Protein Antigen is derived from E
- coli
- The MAGEA10 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4109
Common Name: MAGEA10 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Cancer/testis antigen 1.10, CT1.10member 10, MAGE-10 antigen, melanoma antigen family A, 10, melanoma-associated antigen 10
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MAGEA10
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53241. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4109
Common Name:
MAGEA10 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Cancer/testis antigen 1.10, CT1.10member 10, MAGE-10 antigen, melanoma antigen family A, 10, melanoma-associated antigen 10
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MAGEA10
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53241. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 79039
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: APR-5, ATP-dependent RNA helicase DP97, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, DEAD box helicase 97 KDa, DEAD box protein 54, DEAD box RNA helicase 97 kDa, DP97ATP-dependent RNA helicase DDX54, EC 3.6.1, EC 3.6.4.13, MGC2835
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
79039
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
APR-5, ATP-dependent RNA helicase DP97, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, DEAD box helicase 97 KDa, DEAD box protein 54, DEAD box RNA helicase 97 kDa, DP97ATP-dependent RNA helicase DDX54, EC 3.6.1, EC 3.6.4.13, MGC2835
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 79039
Common Name: DDX54 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: APR-5, ATP-dependent RNA helicase DP97, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, DEAD box helicase 97 KDa, DEAD box protein 54, DEAD box RNA helicase 97 kDa, DP97ATP-dependent RNA helicase DDX54, EC 3.6.1, EC 3.6.4.13, MGC2835
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DDX54
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53242. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
79039
Common Name:
DDX54 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
APR-5, ATP-dependent RNA helicase DP97, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, DEAD box helicase 97 KDa, DEAD box protein 54, DEAD box RNA helicase 97 kDa, DP97ATP-dependent RNA helicase DDX54, EC 3.6.1, EC 3.6.4.13, MGC2835
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DDX54
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53242. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 54845
Common Name: ESRP1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: epithelial splicing regulatory protein 1, FLJ20171, RBM35A, RMB35A, RNA binding motif protein 35A, RNA-binding motif protein 35A, RNA-binding protein 35A
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ESRP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50729. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
54845
Common Name:
ESRP1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
epithelial splicing regulatory protein 1, FLJ20171, RBM35A, RMB35A, RNA binding motif protein 35A, RNA-binding motif protein 35A, RNA-binding protein 35A
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ESRP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50729. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml