NBP257866PE
Novus Biologicals™ SMIM17 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257866PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257866PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
147670
Common Name
SMIM17 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
Small Integral Membrane Protein 17
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SMIM17
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53318. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMIM17
- Source: E.coli Amino Acid Sequence: SHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTTIVLV The SMIM17 Recombinant Protein Antigen is derived from E
- coli
- The SMIM17 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 147670
Common Name: SMIM17 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Small Integral Membrane Protein 17
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SMIM17
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53318. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
147670
Common Name:
SMIM17 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Small Integral Membrane Protein 17
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SMIM17
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53318. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 472
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintenance 1, homolog, TELO1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
472
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintenance 1, homolog, TELO1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 472
Common Name: ATM Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintena
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ATM
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52998. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
472
Common Name:
ATM Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintena
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ATM
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52998. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 54768
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CILD5, HYDIN, Axonemal Central Pair Apparatus Protein, HYDIN2, Hydrocephalus Inducing, Hydrocephalus Inducing Homolog (Mouse), Hydrocephalus-Inducing Protein Homolog, KIAA1864, PPP1R31, Protein Phosphatase 1, Protein Phosphatase 1, Regulatory Subunit 31, Regulatory Subunit 31
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
54768
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CILD5, HYDIN, Axonemal Central Pair Apparatus Protein, HYDIN2, Hydrocephalus Inducing, Hydrocephalus Inducing Homolog (Mouse), Hydrocephalus-Inducing Protein Homolog, KIAA1864, PPP1R31, Protein Phosphatase 1, Protein Phosphatase 1, Regulatory Subunit 31, Regulatory Subunit 31
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__