NBP257943PE
Novus Biologicals™ SERF1A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257943PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257943PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
8293
Common Name
SERF1A Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
FAM2B, h4F5, H4F5small EDRK-rich factor 1,4F5, Protein 4F5, SERF1, SMA modifier 1, small EDRK-rich factor 1A (telomeric), SMAM1FAM2ASERF1B, spinal muscular atrophy-related gene H4F5
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SERF1A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51009. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERF1A
- Source: E.coli Amino Acid Sequence: SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR The SERF1A Recombinant Protein Antigen is derived from E
- coli
- The SERF1A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 8293
Common Name: SERF1A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: FAM2B, h4F5, H4F5small EDRK-rich factor 1,4F5, Protein 4F5, SERF1, SMA modifier 1, small EDRK-rich factor 1A (telomeric), SMAM1FAM2ASERF1B, spinal muscular atrophy-related gene H4F5
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SERF1A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51009. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8293
Common Name:
SERF1A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
FAM2B, h4F5, H4F5small EDRK-rich factor 1,4F5, Protein 4F5, SERF1, SMA modifier 1, small EDRK-rich factor 1A (telomeric), SMAM1FAM2ASERF1B, spinal muscular atrophy-related gene H4F5
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SERF1A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51009. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 50865
Common Name: HEBP1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: HBPHEBP, heme binding protein 1, heme-binding protein 1, p22HBP
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: HEBP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53529. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
50865
Common Name:
HEBP1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
HBPHEBP, heme binding protein 1, heme-binding protein 1, p22HBP
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
HEBP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53529. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 57492
Common Name: ARID1B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: 6A3-5, ARID domain-containing protein 1B, AT rich interactive domain 1B (SWI1-like), BAF250B, BRG1-associated factor 250b, BRG1-binding protein ELD/OSA1, BRG1-binding protein hELD/OSA1, BRIGHT, DAN15P250R, ELD (eyelid)/OSA protein, ELD/OSA1, hOsa2, JPUT1,
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ARID1B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53530. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
57492
Common Name:
ARID1B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
6A3-5, ARID domain-containing protein 1B, AT rich interactive domain 1B (SWI1-like), BAF250B, BRG1-associated factor 250b, BRG1-binding protein ELD/OSA1, BRG1-binding protein hELD/OSA1, BRIGHT, DAN15P250R, ELD (eyelid)/OSA protein, ELD/OSA1, hOsa2, JPUT1,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ARID1B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53530. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 85027
Common Name: SMIM3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C5orf62, Chromosome 5 Open Reading Frame 62, MST150, NGF-Induced Differentiation Clone 67 Protein, NID67, Small Integral Membrane Protein 3, Small Membrane Protein NID67
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SMIM3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53531. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
85027
Common Name:
SMIM3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C5orf62, Chromosome 5 Open Reading Frame 62, MST150, NGF-Induced Differentiation Clone 67 Protein, NID67, Small Integral Membrane Protein 3, Small Membrane Protein NID67
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SMIM3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53531. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml