NBP257975PE
Novus Biologicals™ ITM2B Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257975PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257975PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
9445
Common Name
ITM2B Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
ABRI, ABri/ADan amyloid peptide, BRI2, BRICD2B, BRICHOS domain containing 2B, BRIFBD, E25B, E3-16, integral membrane protein 2B, Protein E25B, Transmembrane protein BRI
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ITM2B
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53331. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITM2B
- Source: E.coli Amino Acid Sequence: MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRA The ITM2B Recombinant Protein Antigen is derived from E
- coli
- The ITM2B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 9445
Common Name: ITM2B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: ABRI, ABri/ADan amyloid peptide, BRI2, BRICD2B, BRICHOS domain containing 2B, BRIFBD, E25B, E3-16, integral membrane protein 2B, Protein E25B, Transmembrane protein BRI
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ITM2B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53331. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9445
Common Name:
ITM2B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
ABRI, ABri/ADan amyloid peptide, BRI2, BRICD2B, BRICHOS domain containing 2B, BRIFBD, E25B, E3-16, integral membrane protein 2B, Protein E25B, Transmembrane protein BRI
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ITM2B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53331. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 111
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AC5, adenylate cyclase 5, adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ATP pyrophosphate-lyase 5, EC 4.6.1.1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
111
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AC5, adenylate cyclase 5, adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ATP pyrophosphate-lyase 5, EC 4.6.1.1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 1459
Common Name: CKII alpha prime polypeptide Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CSNK2A2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53620. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1459
Common Name:
CKII alpha prime polypeptide Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CSNK2A2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53620. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3485
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BP2, IBP2, IBP-2, IGF-binding protein 2, IGFBP-2, IGF-BP53, insulin-like growth factor binding protein 2 (36kD), insulin-like growth factor binding protein 2, 36kDa, insulin-like growth factor-binding protein 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3485
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
BP2, IBP2, IBP-2, IGF-binding protein 2, IGFBP-2, IGF-BP53, insulin-like growth factor binding protein 2 (36kD), insulin-like growth factor binding protein 2, 36kDa, insulin-like growth factor-binding protein 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__