NBP257988PE
Novus Biologicals™ NACA1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257988PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257988PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4666
Common Name
NACA1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
Allergen Hom s 2, Alpha-NAC, MGC117224, NACA1, NAC-alpha, nascent polypeptide-associated complex alpha subunit, nascent polypeptide-associated complex subunit alpha, nascent-polypeptide-associated complex alpha polypeptide
Label Type
Unlabeled
Quantity
100μL
Research Category
DNA replication Transcription Translation and Splicing
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51007. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
NACA
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NACA1
- Source: E.coli Amino Acid Sequence: SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV The NACA1 Recombinant Protein Antigen is derived from E
- coli
- The NACA1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4666
Common Name: NACA1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Allergen Hom s 2, Alpha-NAC, MGC117224, NACA1, NAC-alpha, nascent polypeptide-associated complex alpha subunit, nascent polypeptide-associated complex subunit alpha, nascent-polypeptide-associated complex alpha polypeptide
Label Type: Unlabeled
Quantity: 100μL
Research Category: DNA replication Transcription Translation and Splicing
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51007. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NACA
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
4666
Common Name:
NACA1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Allergen Hom s 2, Alpha-NAC, MGC117224, NACA1, NAC-alpha, nascent polypeptide-associated complex alpha subunit, nascent polypeptide-associated complex subunit alpha, nascent-polypeptide-associated complex alpha polypeptide
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
DNA replication Transcription Translation and Splicing
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51007. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NACA
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 27244
Common Name: SESN1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: MGC138241, MGC142129, p53-regulated protein PA26, PA26p53 activated gene 26, SEST1p53 regulated PA26 nuclear protein, sestrin 1, sestrin-1
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53428. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SESN1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
27244
Common Name:
SESN1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
MGC138241, MGC142129, p53-regulated protein PA26, PA26p53 activated gene 26, SEST1p53 regulated PA26 nuclear protein, sestrin 1, sestrin-1
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53428. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SESN1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 6717
Common Name: SR1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: calcium binding protein amplified in mutlidrug-resistant cells, CP22, CP-22, FLJ26259,22 kDa protein, H_RG167B05.1, SCN, sorcin, V19
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50914. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SRI
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
6717
Common Name:
SR1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
calcium binding protein amplified in mutlidrug-resistant cells, CP22, CP-22, FLJ26259,22 kDa protein, H_RG167B05.1, SCN, sorcin, V19
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50914. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SRI
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 1013
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: cadherin 15, M-cadherin (myotubule), cadherin 15, type 1, M-cadherin (myotubule), Cadherin-14, cadherin-3, CDH14cadherin-14, CDH3cadherin-15, CDHM, MCAD, M-cadherin, MRD3, Muscle cadherin, muscle-cadherin
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
1013
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
cadherin 15, M-cadherin (myotubule), cadherin 15, type 1, M-cadherin (myotubule), Cadherin-14, cadherin-3, CDH14cadherin-14, CDH3cadherin-15, CDHM, MCAD, M-cadherin, MRD3, Muscle cadherin, muscle-cadherin
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__