NBP258022PE
Novus Biologicals™ ULBP-1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258022PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258022PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
80329
Common Name
ULBP-1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
ALCAN-beta, N2DL1, N2DL-1, NKG2D ligand 1, NKG2DL1, RAET1Ialcan-beta, Retinoic acid early transcript 1I, UL16 binding protein 1, UL16-binding protein 1
Label Type
Unlabeled
Quantity
100μL
Research Category
Immunology
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53256. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ULBP1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ULBP-1
- Source: E.coli Amino Acid Sequence: WTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPK The ULBP-1 Recombinant Protein Antigen is derived from E
- coli
- The ULBP-1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 80329
Common Name: ULBP-1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: ALCAN-beta, N2DL1, N2DL-1, NKG2D ligand 1, NKG2DL1, RAET1Ialcan-beta, Retinoic acid early transcript 1I, UL16 binding protein 1, UL16-binding protein 1
Label Type: Unlabeled
Quantity: 100μL
Research Category: Immunology
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53256. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ULBP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
80329
Common Name:
ULBP-1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
ALCAN-beta, N2DL1, N2DL-1, NKG2D ligand 1, NKG2DL1, RAET1Ialcan-beta, Retinoic acid early transcript 1I, UL16 binding protein 1, UL16-binding protein 1
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Immunology
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53256. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ULBP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 9958
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Deubiquitinating enzyme 15, EC 3.1.2.15, EC 3.4.19.12, KIAA0529ubiquitin carboxyl-terminal hydrolase 15, MGC131982, MGC149838, MGC74854, ubiquitin specific peptidase 15, ubiquitin specific protease 15, ubiquitin thioesterase 15, Ubiquitin thiolesterase 15, Ubiquitin-specific-processing protease 15, unph-2, UNPH4
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
9958
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Deubiquitinating enzyme 15, EC 3.1.2.15, EC 3.4.19.12, KIAA0529ubiquitin carboxyl-terminal hydrolase 15, MGC131982, MGC149838, MGC74854, ubiquitin specific peptidase 15, ubiquitin specific protease 15, ubiquitin thioesterase 15, Ubiquitin thiolesterase 15, Ubiquitin-specific-processing protease 15, unph-2, UNPH4
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 9958
Common Name: USP15 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Deubiquitinating enzyme 15, EC 3.1.2.15, EC 3.4.19.12, KIAA0529ubiquitin carboxyl-terminal hydrolase 15, MGC131982, MGC149838, MGC74854, ubiquitin specific peptidase 15, ubiquitin specific protease 15, ubiquitin thioesterase 15, Ubiquitin thiolesterase 15
Label Type: Unlabeled
Quantity: 100μL
Research Category: DNA replication Transcription Translation and Splicing
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53257. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: USP15
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
9958
Common Name:
USP15 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Deubiquitinating enzyme 15, EC 3.1.2.15, EC 3.4.19.12, KIAA0529ubiquitin carboxyl-terminal hydrolase 15, MGC131982, MGC149838, MGC74854, ubiquitin specific peptidase 15, ubiquitin specific protease 15, ubiquitin thioesterase 15, Ubiquitin thiolesterase 15
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
DNA replication Transcription Translation and Splicing
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53257. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
USP15
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 10461
Common Name: Mer Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: c-mer, c-mer proto-oncogene tyrosine kinase, EC 2.7.10, EC 2.7.10.1, MER, MER receptor tyrosine kinase, MGC133349, Receptor tyrosine kinase MerTK, RP38Proto-oncogene c-Mer, STK kinase, tyrosine-protein kinase Mer
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53544. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MERTK
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
10461
Common Name:
Mer Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
c-mer, c-mer proto-oncogene tyrosine kinase, EC 2.7.10, EC 2.7.10.1, MER, MER receptor tyrosine kinase, MGC133349, Receptor tyrosine kinase MerTK, RP38Proto-oncogene c-Mer, STK kinase, tyrosine-protein kinase Mer
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53544. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MERTK
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli