NBP258044PE
Novus Biologicals™ HOXD11 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258044PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258044PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
3237
Common Name
HOXD11 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
homeo box D11, homeobox D11, Homeobox protein Hox-4F, homeobox protein Hox-D11, HOX4, Hox-4.6, mouse, homolog of, HOX4Fhomeo box 4F
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
HOXD11
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51998. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXD11
- Source: E.coli Amino Acid Sequence: FDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAP The HOXD11 Recombinant Protein Antigen is derived from E
- coli
- The HOXD11 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 3237
Common Name: HOXD11 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: homeo box D11, homeobox D11, Homeobox protein Hox-4F, homeobox protein Hox-D11, HOX4, Hox-4.6, mouse, homolog of, HOX4Fhomeo box 4F
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: HOXD11
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51998. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3237
Common Name:
HOXD11 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
homeo box D11, homeobox D11, Homeobox protein Hox-4F, homeobox protein Hox-D11, HOX4, Hox-4.6, mouse, homolog of, HOX4Fhomeo box 4F
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
HOXD11
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51998. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 444
Common Name: Aspartate beta hydroxylase Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: AAH, ASP beta-hydroxylase, aspartate beta-hydroxylaseA beta H-J-J, aspartyl/asparaginyl-beta-hydroxylase, BAH, cardiac junctin, CASQ2BP1, EC 1.14.11.16, HAAHaspartyl/asparaginyl beta-hydroxylase, humbug, JCTN, junctate, junctin, Peptide-aspartate beta-dio
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ASPH
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50290. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
444
Common Name:
Aspartate beta hydroxylase Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
AAH, ASP beta-hydroxylase, aspartate beta-hydroxylaseA beta H-J-J, aspartyl/asparaginyl-beta-hydroxylase, BAH, cardiac junctin, CASQ2BP1, EC 1.14.11.16, HAAHaspartyl/asparaginyl beta-hydroxylase, humbug, JCTN, junctate, junctin, Peptide-aspartate beta-dio
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ASPH
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50290. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 57104
Common Name: PEDFR/PNPLA2/ATGL
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Adipose triglyceride lipase, ATGL1110001C14Rik, Calcium-independent phospholipase A2, Desnutrin, EC 3.1.1.3, FP17548, IPLA2-zeta, patatin-like phospholipase domain containing 2, patatin-like phospholipase domain-containing protein 2, patatin-like phosphol
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PNPLA2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51999. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
57104
Common Name:
PEDFR/PNPLA2/ATGL
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Adipose triglyceride lipase, ATGL1110001C14Rik, Calcium-independent phospholipase A2, Desnutrin, EC 3.1.1.3, FP17548, IPLA2-zeta, patatin-like phospholipase domain containing 2, patatin-like phospholipase domain-containing protein 2, patatin-like phosphol
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PNPLA2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51999. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 121642
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: 2OG-Fe(II) oxy DC1, ABH2FLJ99103, alkB, alkylation repair homolog 2 (E. coli), Alkylated DNA repair protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase alkB homolog 2, EC 1.14.11.-, MGC90512, Oxy DC1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
121642
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
2OG-Fe(II) oxy DC1, ABH2FLJ99103, alkB, alkylation repair homolog 2 (E. coli), Alkylated DNA repair protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase alkB homolog 2, EC 1.14.11.-, MGC90512, Oxy DC1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__