NBP258065PE
Novus Biologicals™ CRALBP Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258065PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258065PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
6017
Common Name
CRALBP Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Cellular retinaldehyde-binding protein, cellular retinaldehyde-binding protein-1, CRALBPretinaldehyde-binding protein 1, MGC3663, retinaldehyde binding protein 1
Label Type
Unlabeled
Quantity
100μL
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51440. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
RLBP1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRALBP
- Source: E.coli Amino Acid Sequence: PARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSD The CRALBP Recombinant Protein Antigen is derived from E
- coli
- The CRALBP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 6017
Common Name: CRALBP Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Cellular retinaldehyde-binding protein, cellular retinaldehyde-binding protein-1, CRALBPretinaldehyde-binding protein 1, MGC3663, retinaldehyde binding protein 1
Label Type: Unlabeled
Quantity: 100μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51440. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RLBP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Gene ID (Entrez):
6017
Common Name:
CRALBP Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Cellular retinaldehyde-binding protein, cellular retinaldehyde-binding protein-1, CRALBPretinaldehyde-binding protein 1, MGC3663, retinaldehyde binding protein 1
Label Type:
Unlabeled
Quantity:
100μL
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51440. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RLBP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Gene ID (Entrez): 9973
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: copper chaperone for superoxide dismutase, MGC138260, Superoxide dismutase copper chaperone
Label Type: __
Quantity: 100 μL
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Gene ID (Entrez):
9973
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
copper chaperone for superoxide dismutase, MGC138260, Superoxide dismutase copper chaperone
Label Type:
__
Quantity:
100 μL
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Gene ID (Entrez): 9973
Common Name: CCS/SOD4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: copper chaperone for superoxide dismutase, MGC138260, Superoxide dismutase copper chaperone
Label Type: Unlabeled
Quantity: 100μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50053. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CCS
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Gene ID (Entrez):
9973
Common Name:
CCS/SOD4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
copper chaperone for superoxide dismutase, MGC138260, Superoxide dismutase copper chaperone
Label Type:
Unlabeled
Quantity:
100μL
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50053. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CCS
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Gene ID (Entrez): 3190
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: dC-stretch binding protein, FLJ41122, heterogeneous nuclear ribonucleoprotein K, hnRNP K, transformation upregulated nuclear protein, Transformation up-regulated nuclear protein, TUNPHNRPKCSBP
Label Type: __
Quantity: 100 μL
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Gene ID (Entrez):
3190
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
dC-stretch binding protein, FLJ41122, heterogeneous nuclear ribonucleoprotein K, hnRNP K, transformation upregulated nuclear protein, Transformation up-regulated nuclear protein, TUNPHNRPKCSBP
Label Type:
__
Quantity:
100 μL
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO