NBP258095PE
Novus Biologicals™ DNA helicase HEL308 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258095PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258095PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
113510
Common Name
DNA helicase HEL308 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 3.6.1, EC 3.6.4.12, Hel308, HEL308DNA helicase HEL308, helicase POLQ-like, helicase, POLQ-like, MGC20604, Mus308-like helicase, POLQ-like helicase
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
HELQ
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51302. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNA helicase HEL308
- Source: E.coli Amino Acid Sequence: SGYEGVTIEPGADLLYDVPSSQAIYFENLQNSSNDLGDHSMKERDWKSSSHNTVNEELPHNCIEQPQQNDESSSKV The DNA helicase HEL308 Recombinant Protein Antigen is derived from E
- coli
- The DNA helicase HEL308 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 113510
Common Name: DNA helicase HEL308 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 3.6.1, EC 3.6.4.12, Hel308, HEL308DNA helicase HEL308, helicase POLQ-like, helicase, POLQ-like, MGC20604, Mus308-like helicase, POLQ-like helicase
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: HELQ
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51302. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
113510
Common Name:
DNA helicase HEL308 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 3.6.1, EC 3.6.4.12, Hel308, HEL308DNA helicase HEL308, helicase POLQ-like, helicase, POLQ-like, MGC20604, Mus308-like helicase, POLQ-like helicase
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
HELQ
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51302. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8622
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: 3'-5' cyclic nucleotide phosphodiesterase 8B, ADSD, Cell proliferation-inducing gene 22 protein, EC 3.1.4.17, FLJ11212, high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8B, hsPDE8B, phosphodiesterase 8B, PPNAD3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8622
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
3'-5' cyclic nucleotide phosphodiesterase 8B, ADSD, Cell proliferation-inducing gene 22 protein, EC 3.1.4.17, FLJ11212, high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8B, hsPDE8B, phosphodiesterase 8B, PPNAD3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 84640
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Deubiquitinating enzyme 38, EC 3.4.19.12, HP43.8KDFLJ35970, KIAA1891ubiquitin specific protease 38, ubiquitin carboxyl-terminal hydrolase 38, ubiquitin specific peptidase 38, ubiquitin thioesterase 38, Ubiquitin thiolesterase 38, Ubiquitin-specific-processing protease 38
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
84640
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Deubiquitinating enzyme 38, EC 3.4.19.12, HP43.8KDFLJ35970, KIAA1891ubiquitin specific protease 38, ubiquitin carboxyl-terminal hydrolase 38, ubiquitin specific peptidase 38, ubiquitin thioesterase 38, Ubiquitin thiolesterase 38, Ubiquitin-specific-processing protease 38
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 84640
Common Name: USP38 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Deubiquitinating enzyme 38, EC 3.4.19.12, HP43.8KDFLJ35970, KIAA1891ubiquitin specific protease 38, ubiquitin carboxyl-terminal hydrolase 38, ubiquitin specific peptidase 38, ubiquitin thioesterase 38, Ubiquitin thiolesterase 38, Ubiquitin-specific-proces
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: USP38
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
84640
Common Name:
USP38 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Deubiquitinating enzyme 38, EC 3.4.19.12, HP43.8KDFLJ35970, KIAA1891ubiquitin specific protease 38, ubiquitin carboxyl-terminal hydrolase 38, ubiquitin specific peptidase 38, ubiquitin thioesterase 38, Ubiquitin thiolesterase 38, Ubiquitin-specific-proces
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
USP38
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51304. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml