NBP258145PE
Novus Biologicals™ OBFC2B Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258145PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258145PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
79035
Common Name
OBFC2B Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
LP3587, MGC2731, oligonucleotide/oligosaccharide-binding fold containing 2B, Oligonucleotide/oligosaccharide-binding fold-containing protein 2B, Sensor of single-strand DNA complex subunit B1, Sensor of ssDNA subunit B1, Single-stranded DNA-binding protei
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
NABP2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52155. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OBFC2B
- Source: E.coli Amino Acid Sequence: FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS The OBFC2B Recombinant Protein Antigen is derived from E
- coli
- The OBFC2B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 79035
Common Name: OBFC2B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: LP3587, MGC2731, oligonucleotide/oligosaccharide-binding fold containing 2B, Oligonucleotide/oligosaccharide-binding fold-containing protein 2B, Sensor of single-strand DNA complex subunit B1, Sensor of ssDNA subunit B1, Single-stranded DNA-binding protei
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NABP2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52155. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
79035
Common Name:
OBFC2B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
LP3587, MGC2731, oligonucleotide/oligosaccharide-binding fold containing 2B, Oligonucleotide/oligosaccharide-binding fold-containing protein 2B, Sensor of single-strand DNA complex subunit B1, Sensor of ssDNA subunit B1, Single-stranded DNA-binding protei
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NABP2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52155. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 55655
Common Name: NLRP2/NALP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CLR19.9, FLJ20510, NACHT, leucine rich repeat and PYD containing 2, NACHT, LRR and PYD domains-containing protein 2, NALP2NACHT, LRR and PYD containing protein 2, NBS1PYRIN-containing APAF1-like protein 2, NLR family, pyrin domain containing 2, nucleotide
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NLRP2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49820. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55655
Common Name:
NLRP2/NALP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CLR19.9, FLJ20510, NACHT, leucine rich repeat and PYD containing 2, NACHT, LRR and PYD domains-containing protein 2, NALP2NACHT, LRR and PYD containing protein 2, NBS1PYRIN-containing APAF1-like protein 2, NLR family, pyrin domain containing 2, nucleotide
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NLRP2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49820. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51117
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CGI-92, Coenzyme Q biosynthesis protein 4 homolog, coenzyme Q4 homolog (S. cerevisiae), coenzyme Q4 homolog (yeast), ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
51117
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CGI-92, Coenzyme Q biosynthesis protein 4 homolog, coenzyme Q4 homolog (S. cerevisiae), coenzyme Q4 homolog (yeast), ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 51117
Common Name: COQ4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CGI-92, Coenzyme Q biosynthesis protein 4 homolog, coenzyme Q4 homolog (S. cerevisiae), coenzyme Q4 homolog (yeast), ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: COQ4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51106. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51117
Common Name:
COQ4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CGI-92, Coenzyme Q biosynthesis protein 4 homolog, coenzyme Q4 homolog (S. cerevisiae), coenzyme Q4 homolog (yeast), ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
COQ4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51106. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml