NBP258213PE
Novus Biologicals™ TCF7/TCF1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258213PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258213PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
6932
Common Name
TCF7/TCF1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
FLJ36364, MGC47735, T-cell factor 1, T-cell specific, TCF1, TCF-7, transcription factor 7 (T-cell specific, HMG-box)
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
TCF7
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52310. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TCF7/TCF1
- Source: E.coli Amino Acid Sequence: KKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAE The TCF7/TCF1 Recombinant Protein Antigen is derived from E
- coli
- The TCF7/TCF1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 6932
Common Name: TCF7/TCF1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FLJ36364, MGC47735, T-cell factor 1, T-cell specific, TCF1, TCF-7, transcription factor 7 (T-cell specific, HMG-box)
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TCF7
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52310. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6932
Common Name:
TCF7/TCF1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FLJ36364, MGC47735, T-cell factor 1, T-cell specific, TCF1, TCF-7, transcription factor 7 (T-cell specific, HMG-box)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TCF7
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52310. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23205
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: acyl-CoA synthetase bubblegum family member 1EC 6.2.1.3, BG1, BGMBG, bubblegum, FLJ30320, hBG1, hsBG, hsBGM, KIAA0631GR-LACS, lipidosin, long-chain-fatty-acid--CoA ligase ACSBG1, LPD, MGC14352, very long-chain acyl-CoA synthetase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23205
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
acyl-CoA synthetase bubblegum family member 1EC 6.2.1.3, BG1, BGMBG, bubblegum, FLJ30320, hBG1, hsBG, hsBGM, KIAA0631GR-LACS, lipidosin, long-chain-fatty-acid--CoA ligase ACSBG1, LPD, MGC14352, very long-chain acyl-CoA synthetase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 51514
Common Name: CDT2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CDT2RA-regulated nuclear matrix-associated protein, CDW1, DCAF2DDB1 and CUL4 associated factor 2, DDB1- and CUL4-associated factor 2, denticleless homolog (Drosophila), L2DTLRA regulated nuclear matrix associated protein, Lethal(2) denticleless protein ho
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DTL
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51241. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51514
Common Name:
CDT2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CDT2RA-regulated nuclear matrix-associated protein, CDW1, DCAF2DDB1 and CUL4 associated factor 2, DDB1- and CUL4-associated factor 2, denticleless homolog (Drosophila), L2DTLRA regulated nuclear matrix associated protein, Lethal(2) denticleless protein ho
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DTL
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51241. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51514
Common Name: CDT2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CDT2RA-regulated nuclear matrix-associated protein, CDW1, DCAF2DDB1 and CUL4 associated factor 2, DDB1- and CUL4-associated factor 2, denticleless homolog (Drosophila), L2DTLRA regulated nuclear matrix associated protein, Lethal(2) denticleless protein ho
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DTL
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51242. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51514
Common Name:
CDT2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CDT2RA-regulated nuclear matrix-associated protein, CDW1, DCAF2DDB1 and CUL4 associated factor 2, DDB1- and CUL4-associated factor 2, denticleless homolog (Drosophila), L2DTLRA regulated nuclear matrix associated protein, Lethal(2) denticleless protein ho
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DTL
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51242. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml