NBP258232PE
Novus Biologicals™ CCNL1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258232PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258232PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
57018
Common Name
CCNL1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
ania-6a, ANIA6A, cyclin L ania-6a, cyclin L gamma, cyclin L1, cyclin-L, cyclin-L1, PRO1073
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CCNL1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50376. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCNL1
- Source: E.coli Amino Acid Sequence: SKPSSPREVKAEEKSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRS The CCNL1 Recombinant Protein Antigen is derived from E
- coli
- The CCNL1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 57018
Common Name: CCNL1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ania-6a, ANIA6A, cyclin L ania-6a, cyclin L gamma, cyclin L1, cyclin-L, cyclin-L1, PRO1073
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CCNL1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50376. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
57018
Common Name:
CCNL1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ania-6a, ANIA6A, cyclin L ania-6a, cyclin L gamma, cyclin L1, cyclin-L, cyclin-L1, PRO1073
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CCNL1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50376. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 64747
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FLJ14153, major facilitator superfamily domain containing 1, major facilitator superfamily domain-containing protein 1, SMAP4, SMAP-4, Smooth muscle cell-associated protein 4, UG0581B09
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
64747
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FLJ14153, major facilitator superfamily domain containing 1, major facilitator superfamily domain-containing protein 1, SMAP4, SMAP-4, Smooth muscle cell-associated protein 4, UG0581B09
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 6396
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: D3S1231ESEC13L1npp-20, protein SEC13 homolog, SEC13 (S. cerevisiae)-like 1, SEC13 homolog (S. cerevisiae), SEC13L1, SEC13-like 1 isoform, SEC13-like protein 1, SEC13-related protein, SEC13RSEC13-like 1 (S. cerevisiae)
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
6396
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
D3S1231ESEC13L1npp-20, protein SEC13 homolog, SEC13 (S. cerevisiae)-like 1, SEC13 homolog (S. cerevisiae), SEC13L1, SEC13-like 1 isoform, SEC13-like protein 1, SEC13-related protein, SEC13RSEC13-like 1 (S. cerevisiae)
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 51072
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading frame 4, NS5ATP7, protein MEMO1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
51072
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading frame 4, NS5ATP7, protein MEMO1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__