NBP258236PE
Novus Biologicals™ mediator of cell motility 1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258236PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258236PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
51072
Common Name
mediator of cell motility 1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading
Label Type
Unlabeled
Quantity
100μL
Research Category
Signal Transduction
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52203. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MEMO1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.Coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human mediator of cell motility 1
- Source: E.coli Amino Acid Sequence: MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRI The mediator of cell motility 1 Recombinant Protein Antigen is derived from E
- coli
- The mediator of cell motility 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51072
Common Name: mediator of cell motility 1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading
Label Type: Unlabeled
Quantity: 100μL
Research Category: Signal Transduction
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52203. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MEMO1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
51072
Common Name:
mediator of cell motility 1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Signal Transduction
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52203. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MEMO1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 122809
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CIS4, DKFZp686J1568, SOCS-4, SOCS7, SOCS-7, SSI4, STAT4, suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7SH2 domain containing SOCS box protein
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
122809
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CIS4, DKFZp686J1568, SOCS-4, SOCS7, SOCS-7, SSI4, STAT4, suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7SH2 domain containing SOCS box protein
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 122809
Common Name: SOCS-4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CIS4, DKFZp686J1568, SOCS-4, SOCS7, SOCS-7, SSI4, STAT4, suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7SH2 domain containing SOCS box protein
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52205. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SOCS4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
122809
Common Name:
SOCS-4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CIS4, DKFZp686J1568, SOCS-4, SOCS7, SOCS-7, SSI4, STAT4, suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7SH2 domain containing SOCS box protein
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52205. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SOCS4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 26048
Common Name: ZNF500 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C2H2-171, RP58Zinc finger and BTB domain-containing protein 18, TAZ1, TAZ-1Zinc finger protein C2H2-171, Transcriptional repressor RP58, Translin-associated zinc finger protein 1, ZBTB1858 kDa repressor protein, zinc finger protein 238
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52206. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ZNF500
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
26048
Common Name:
ZNF500 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C2H2-171, RP58Zinc finger and BTB domain-containing protein 18, TAZ1, TAZ-1Zinc finger protein C2H2-171, Transcriptional repressor RP58, Translin-associated zinc finger protein 1, ZBTB1858 kDa repressor protein, zinc finger protein 238
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52206. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ZNF500
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli