NBP258256PE
Novus Biologicals™ Cytokeratin 12 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258256PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258256PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
3859
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Common Name
Cytokeratin 12 Recombinant Protein Antigen
Formulation
PBS and 1 M Urea, pH 7.4.
Gene Alias
keratin, type I cytoskeletal 12, K12, keratin 12
Label Type
Unlabeled
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52060. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family
Cytokeratin 12
Purity
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application)
Antibody Competition
Gene Symbol
KRT12
Molecular Weight (g/mol)
M.W. (theoretical): 21 kDa
Quantity
100 μL
Source
E.Coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cytokeratin 12
- Source: E.coli Amino Acid Sequence: QGDGLEESLFVTDSKSQAQSTDSSKDPTKTRK The Cytokeratin 12 Recombinant Protein Antigen is derived from E
- coli
- The Cytokeratin 12 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 3859
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Common Name: Cytokeratin 12 Recombinant Protein Antigen
Formulation: PBS and 1 M Urea, pH 7.4.
Gene Alias: keratin, type I cytoskeletal 12, K12, keratin 12
Label Type: Unlabeled
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52060. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family: Cytokeratin 12
Purity: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: KRT12
Molecular Weight (g/mol): M.W. (theoretical): 21 kDa
Quantity: 100 μL
Source: E.Coli
Gene ID (Entrez):
3859
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Common Name:
Cytokeratin 12 Recombinant Protein Antigen
Formulation:
PBS and 1 M Urea, pH 7.4.
Gene Alias:
keratin, type I cytoskeletal 12, K12, keratin 12
Label Type:
Unlabeled
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52060. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family:
Cytokeratin 12
Purity:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at -20 C. Avoid freeze-thaw cycles.
For Use With (Application):
Antibody Competition
Gene Symbol:
KRT12
Molecular Weight (g/mol):
M.W. (theoretical): 21 kDa
Quantity:
100 μL
Source:
E.Coli
Gene ID (Entrez): 3299
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Common Name: HSF4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: cataract, Marner, heat shock factor protein 4, heat shock transcription factor 4CTM, hHSF4, HSF 4, HSTF 4
Label Type: Unlabeled
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50130. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family: __
Purity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: HSF4
Molecular Weight (g/mol): __
Quantity: 100μL
Source: E.Coli
Gene ID (Entrez):
3299
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Common Name:
HSF4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
cataract, Marner, heat shock factor protein 4, heat shock transcription factor 4CTM, hHSF4, HSF 4, HSTF 4
Label Type:
Unlabeled
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50130. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family:
__
Purity:
__
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
HSF4
Molecular Weight (g/mol):
__
Quantity:
100μL
Source:
E.Coli
Gene ID (Entrez): 80004
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Common Name: ESRP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: epithelial splicing regulatory protein 2, FLJ21918, FLJ22248, RBM35BRNA-binding protein 35B, RNA binding motif protein 35A, RNA binding motif protein 35B, RNA-binding motif protein 35B
Label Type: Unlabeled
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50131. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family: __
Purity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ESRP2
Molecular Weight (g/mol): __
Quantity: 100μL
Source: E.Coli
Gene ID (Entrez):
80004
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Common Name:
ESRP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
epithelial splicing regulatory protein 2, FLJ21918, FLJ22248, RBM35BRNA-binding protein 35B, RNA binding motif protein 35A, RNA binding motif protein 35B, RNA-binding motif protein 35B
Label Type:
Unlabeled
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50131. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family:
__
Purity:
__
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ESRP2
Molecular Weight (g/mol):
__
Quantity:
100μL
Source:
E.Coli
Gene ID (Entrez): 8438
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Common Name: RAD54L Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 3.6.1, hHR54EC 3.6.4.-, HR54, hRAD54HRAD54, RAD54 (S.cerevisiae)-like, RAD54 homolog, RAD54ADNA repair and recombination protein RAD54-like, RAD54-like (S. cerevisiae)
Label Type: Unlabeled
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51724. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family: __
Purity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RAD54L
Molecular Weight (g/mol): __
Quantity: 100μL
Source: E.Coli
Gene ID (Entrez):
8438
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Common Name:
RAD54L Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 3.6.1, hHR54EC 3.6.4.-, HR54, hRAD54HRAD54, RAD54 (S.cerevisiae)-like, RAD54 homolog, RAD54ADNA repair and recombination protein RAD54-like, RAD54-like (S. cerevisiae)
Label Type:
Unlabeled
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51724. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Protein Family:
__
Purity:
__
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RAD54L
Molecular Weight (g/mol):
__
Quantity:
100μL
Source:
E.Coli