NBP258358PE
Novus Biologicals™ RCBTB1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258358PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258358PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
55213
Common Name
RCBTB1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Chronic lymphocytic leukemia deletion region gene 7 protein, CLL deletion region gene 7 protein, CLLD7MGC33184, CLLL7, E4.5, FLJ10716, GDP/GTP exchange factor (GEF)-like protein, GLP, RCC1 and BTB domain-containing protein 1, regulator of chromosome conde
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
RCBTB1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50335. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RCBTB1
- Source: E.coli Amino Acid Sequence: RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY The RCBTB1 Recombinant Protein Antigen is derived from E
- coli
- The RCBTB1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 55213
Common Name: RCBTB1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Chronic lymphocytic leukemia deletion region gene 7 protein, CLL deletion region gene 7 protein, CLLD7MGC33184, CLLL7, E4.5, FLJ10716, GDP/GTP exchange factor (GEF)-like protein, GLP, RCC1 and BTB domain-containing protein 1, regulator of chromosome conde
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RCBTB1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50335. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55213
Common Name:
RCBTB1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Chronic lymphocytic leukemia deletion region gene 7 protein, CLL deletion region gene 7 protein, CLLD7MGC33184, CLLL7, E4.5, FLJ10716, GDP/GTP exchange factor (GEF)-like protein, GLP, RCC1 and BTB domain-containing protein 1, regulator of chromosome conde
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RCBTB1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50335. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 55687
Common Name: TRMT1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 2.8.1, EC 2.8.1.-, FLJ10140, mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase, mitochondrial tRNA-specific 2-thiouridylase 1, MTO2 homolog, MTO2MGC99627, MTU1, TRMT, TRMT1, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TRMT1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50035. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55687
Common Name:
TRMT1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 2.8.1, EC 2.8.1.-, FLJ10140, mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase, mitochondrial tRNA-specific 2-thiouridylase 1, MTO2 homolog, MTO2MGC99627, MTU1, TRMT, TRMT1, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TRMT1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50035. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 90390
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: mediator complex subunit 30TRAP/Mediator complex component TRAP25, mediator of RNA polymerase II transcription subunit 30, putative mediator of RNA polymerase II transcription subunit 30, THRAP6MGC9890, thyroid hormone receptor associated protein 6, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein complex 25 kDa component, Trap25, TRAP25MED30S
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
90390
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
mediator complex subunit 30TRAP/Mediator complex component TRAP25, mediator of RNA polymerase II transcription subunit 30, putative mediator of RNA polymerase II transcription subunit 30, THRAP6MGC9890, thyroid hormone receptor associated protein 6, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein complex 25 kDa component, Trap25, TRAP25MED30S
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 90390
Common Name: MED30 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: mediator complex subunit 30TRAP/Mediator complex component TRAP25, mediator of RNA polymerase II transcription subunit 30, putative mediator of RNA polymerase II transcription subunit 30, THRAP6MGC9890, thyroid hormone receptor associated protein 6, Thyro
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MED30
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51478. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
90390
Common Name:
MED30 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
mediator complex subunit 30TRAP/Mediator complex component TRAP25, mediator of RNA polymerase II transcription subunit 30, putative mediator of RNA polymerase II transcription subunit 30, THRAP6MGC9890, thyroid hormone receptor associated protein 6, Thyro
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MED30
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51478. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml