NBP258472PE

Novus Biologicals™ DTX1 Recombinant Protein Antigen

Manufacturer: Novus Biologicals™

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP258472PE-Each-of-1 In Stock ₹ 30,159.90

NBP258472PE - Each of 1

₹ 30,159.90

In Stock

Quantity

1

Base Price: ₹ 30,159.90

GST (18%): ₹ 5,428.782

Total Price: ₹ 35,588.682

Gene ID (Entrez)

1840

Common Name

DTX1 Recombinant Protein Antigen

Formulation

PBS and 1M Urea, pH 7.4.

Gene Alias

deltex homolog 1 (Drosophila), deltex1, hDTX1, hDx-1, protein deltex-1

Label Type

Unlabeled

Quantity

100μL

Source

E.Coli

Purification Method

>80% by SDS-PAGE and Coomassie blue staining

Content And Storage

Store at −20C. Avoid freeze-thaw cycles.

For Use With (Application)

Blocking/Neutralizing, Control

Gene Symbol

DTX1

Product Type

Recombinant Protein Antigen

Regulatory Status

RUO

Specific Reactivity

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50292. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Related Products

Img

Novus Biologicals™

NBP258545PE

--

Img

Novus Biologicals™

NBP259010PE

--

Img

Novus Biologicals™

NBP258571PE

--

Img

Novus Biologicals™

NBP258530PE

--

Img

Novus Biologicals™

NBP258467PE

--

Img

Novus Biologicals™

NBP258465PE

--

Img

Novus Biologicals™

NBP258269PE

--

Img

Novus Biologicals™

NBP258650PE

--

Description

  • A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DTX1
  • Source: E.coli Amino Acid Sequence: PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP The DTX1 Recombinant Protein Antigen is derived from E
  • coli
  • The DTX1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Compare Similar Items

Show Difference

Img

Novus Biologicals™

NBP258472PE

--


Gene ID (Entrez):
1840

Common Name:
DTX1 Recombinant Protein Antigen

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Alias:
deltex homolog 1 (Drosophila), deltex1, hDTX1, hDx-1, protein deltex-1

Label Type:
Unlabeled

Quantity:
100μL

Source:
E.Coli

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Gene Symbol:
DTX1

Product Type:
Recombinant Protein Antigen

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50292. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Fischer Scientific

NBP258473

--


Gene ID (Entrez):
55362

Common Name:
__

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Alias:
transmembrane protein 63B

Label Type:
__

Quantity:
100 μL

Source:
__

Purification Method:
Affinity Purified

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Gene Symbol:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__

Img

Fischer Scientific

NBP258474

--


Gene ID (Entrez):
63977

Common Name:
__

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Alias:
C21orf83, chromosome 21 open reading frame 83, PFM15, PR domain containing 15, PR domain zinc finger protein 15, PR domain-containing protein 15, Zinc finger protein 298, ZNF298

Label Type:
__

Quantity:
100 μL

Source:
__

Purification Method:
Affinity Purified

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Gene Symbol:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__

Img

Novus Biologicals™

NBP258474PE

--


Gene ID (Entrez):
63977

Common Name:
PRDM15 Recombinant Protein Antigen

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Alias:
C21orf83, chromosome 21 open reading frame 83, PFM15, PR domain containing 15, PR domain zinc finger protein 15, PR domain-containing protein 15, Zinc finger protein 298, ZNF298

Label Type:
Unlabeled

Quantity:
100μL

Source:
E.Coli

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Gene Symbol:
PRDM15

Product Type:
Recombinant Protein Antigen

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51166. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml