NBP258491PE

Novus Biologicals™ TICRR Recombinant Protein Antigen

Manufacturer: Novus Biologicals™

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP258491PE-Each-of-1 In Stock ₹ 30,159.90

NBP258491PE - Each of 1

₹ 30,159.90

In Stock

Quantity

1

Base Price: ₹ 30,159.90

GST (18%): ₹ 5,428.782

Total Price: ₹ 35,588.682

Gene ID (Entrez)

90381

Common Name

TICRR Recombinant Protein Antigen

Formulation

PBS and 1M Urea, pH 7.4.

Gene Alias

C15orf42, Chromosome 15 Open Reading Frame 42, SLD3, SLD3 Homolog, SLD3 Homolog (S. Cerevisiae), TOPBP1-Interacting Checkpoint And Replication Regulator, TOPBP1-Interacting Replication-Stimulating Protein, TopBP1-Interacting, Replication-Stimulating Prote

Label Type

Unlabeled

Quantity

100μL

Source

E.Coli

Purification Method

>80% by SDS-PAGE and Coomassie blue staining

Content And Storage

Store at −20C. Avoid freeze-thaw cycles.

For Use With (Application)

Blocking/Neutralizing, Control

Gene Symbol

TICRR

Product Type

Recombinant Protein Antigen

Regulatory Status

RUO

Specific Reactivity

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51622. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Related Products

Img

Novus Biologicals™

NBP258614PE

--

Img

Novus Biologicals™

NBP258348PE

--

Img

Novus Biologicals™

NBP258255PE

--

Img

Novus Biologicals™

NBP258665PE

--

Img

Novus Biologicals™

NBP258542PE

--

Img

Novus Biologicals™

NBP258468PE

--

Img

Novus Biologicals™

NBP258768PE

--

Img

Novus Biologicals™

NBP258856PE

--

Description

  • A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TICRR
  • Source: E.coli Amino Acid Sequence: DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE The TICRR Recombinant Protein Antigen is derived from E
  • coli
  • The TICRR Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Compare Similar Items

Show Difference

Img

Novus Biologicals™

NBP258491PE

--


Gene ID (Entrez):
90381

Common Name:
TICRR Recombinant Protein Antigen

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Alias:
C15orf42, Chromosome 15 Open Reading Frame 42, SLD3, SLD3 Homolog, SLD3 Homolog (S. Cerevisiae), TOPBP1-Interacting Checkpoint And Replication Regulator, TOPBP1-Interacting Replication-Stimulating Protein, TopBP1-Interacting, Replication-Stimulating Prote

Label Type:
Unlabeled

Quantity:
100μL

Source:
E.Coli

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Gene Symbol:
TICRR

Product Type:
Recombinant Protein Antigen

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51622. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Fischer Scientific

NBP258492

--


Gene ID (Entrez):
5192

Common Name:
__

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Alias:
NALD, peroxin 10, Peroxin-10, peroxisomal biogenesis factor 10MGC1998, Peroxisome assembly protein 10, RING finger protein 69, RNF69peroxisome biogenesis factor 10

Label Type:
__

Quantity:
100 μL

Source:
__

Purification Method:
Affinity Purified

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Gene Symbol:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__

Img

Novus Biologicals™

NBP258492PE

--


Gene ID (Entrez):
5192

Common Name:
PEX10 Recombinant Protein Antigen

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Alias:
NALD, peroxin 10, Peroxin-10, peroxisomal biogenesis factor 10MGC1998, Peroxisome assembly protein 10, RING finger protein 69, RNF69peroxisome biogenesis factor 10

Label Type:
Unlabeled

Quantity:
100μL

Source:
E.Coli

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Gene Symbol:
PEX10

Product Type:
Recombinant Protein Antigen

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51623. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Fischer Scientific

NBP258493

--


Gene ID (Entrez):
29123

Common Name:
__

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Alias:
ANCO-1, ANCO1ankyrin repeat domain-containing protein 11, ankyrin repeat domain 11, Ankyrin repeat-containing cofactor 1, ankyrin repeat-containing protein 11, LZ16, nasopharyngeal carcinoma susceptibility protein, T13

Label Type:
__

Quantity:
100 μL

Source:
__

Purification Method:
Affinity Purified

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Gene Symbol:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__