NBP258498PE
Novus Biologicals™ DNA Primase large subunit Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258498PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258498PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5558
Common Name
DNA Primase large subunit Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
dJ422B11.1.1, DNA primase 58 kDa subunit, DNA primase subunit p58, EC 2.7.7, EC 2.7.7.-, MGC75142, p58, polypeptide 2A, p58, PRIM2ADNA primase large subunit, primase polypeptide 2A, 58kDa, primase, DNA, polypeptide 2 (58kDa), primase, polypeptide 2A (58kD
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PRIM2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51510. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNA Primase large subunit
- Source: E.coli Amino Acid Sequence: ASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRR The DNA Primase large subunit Recombinant Protein Antigen is derived from E
- coli
- The DNA Primase large subunit Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5558
Common Name: DNA Primase large subunit Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: dJ422B11.1.1, DNA primase 58 kDa subunit, DNA primase subunit p58, EC 2.7.7, EC 2.7.7.-, MGC75142, p58, polypeptide 2A, p58, PRIM2ADNA primase large subunit, primase polypeptide 2A, 58kDa, primase, DNA, polypeptide 2 (58kDa), primase, polypeptide 2A (58kD
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PRIM2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51510. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5558
Common Name:
DNA Primase large subunit Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
dJ422B11.1.1, DNA primase 58 kDa subunit, DNA primase subunit p58, EC 2.7.7, EC 2.7.7.-, MGC75142, p58, polypeptide 2A, p58, PRIM2ADNA primase large subunit, primase polypeptide 2A, 58kDa, primase, DNA, polypeptide 2 (58kDa), primase, polypeptide 2A (58kD
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PRIM2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51510. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7392
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BHLHB12, bHLHb12upstream stimulatory factor 2, Class B basic helix-loop-helix protein 12, FIPc-fos interacting protein, FOS-interacting protein, Major late transcription factor 2, Upstream transcription factor 2, upstream transcription factor 2, c-fos interacting
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7392
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
BHLHB12, bHLHb12upstream stimulatory factor 2, Class B basic helix-loop-helix protein 12, FIPc-fos interacting protein, FOS-interacting protein, Major late transcription factor 2, Upstream transcription factor 2, upstream transcription factor 2, c-fos interacting
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 7392
Common Name: USF2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: BHLHB12, bHLHb12upstream stimulatory factor 2, Class B basic helix-loop-helix protein 12, FIPc-fos interacting protein, FOS-interacting protein, Major late transcription factor 2, Upstream transcription factor 2, upstream transcription factor 2, c-fos int
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: USF2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51511. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7392
Common Name:
USF2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
BHLHB12, bHLHb12upstream stimulatory factor 2, Class B basic helix-loop-helix protein 12, FIPc-fos interacting protein, FOS-interacting protein, Major late transcription factor 2, Upstream transcription factor 2, upstream transcription factor 2, c-fos int
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
USF2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51511. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 54952
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FLJ20503, PRO1902, SECp43, SECP43RP4-669K10.4, tRNA selenocysteine 1 associated protein 1, tRNA selenocysteine 1-associated protein 1, tRNA selenocysteine associated protein (SECP43), tRNA selenocysteine associated protein 1, tRNA selenocysteine-associated protein 1, TRSPAP1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
54952
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FLJ20503, PRO1902, SECp43, SECP43RP4-669K10.4, tRNA selenocysteine 1 associated protein 1, tRNA selenocysteine 1-associated protein 1, tRNA selenocysteine associated protein (SECP43), tRNA selenocysteine associated protein 1, tRNA selenocysteine-associated protein 1, TRSPAP1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__