NBP258539PE
Novus Biologicals™ MEF2A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258539PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258539PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4205
Common Name
MEF2A Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
ADCAD1, MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A), MEF2, myocyte enhancer factor 2A, myocyte-specific enhancer factor 2A, RSRFC4, RSRFC9, Serum response factor-like protein 1
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MEF2A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51512. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MEF2A
- Source: E.coli Amino Acid Sequence: DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP The MEF2A Recombinant Protein Antigen is derived from E
- coli
- The MEF2A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4205
Common Name: MEF2A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ADCAD1, MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A), MEF2, myocyte enhancer factor 2A, myocyte-specific enhancer factor 2A, RSRFC4, RSRFC9, Serum response factor-like protein 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MEF2A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51512. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4205
Common Name:
MEF2A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ADCAD1, MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A), MEF2, myocyte enhancer factor 2A, myocyte-specific enhancer factor 2A, RSRFC4, RSRFC9, Serum response factor-like protein 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MEF2A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51512. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 57126
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CD177 antigenNB1 GP, CD177 molecule, HNA-2a, HNA2Acell surface receptor, Human neutrophil alloantigen 2a, NB1PRV-1, polycythemia rubra vera 1, Polycythemia rubra vera protein 1, PRV1NB1 glycoprotein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
57126
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CD177 antigenNB1 GP, CD177 molecule, HNA-2a, HNA2Acell surface receptor, Human neutrophil alloantigen 2a, NB1PRV-1, polycythemia rubra vera 1, Polycythemia rubra vera protein 1, PRV1NB1 glycoprotein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 57126
Common Name: CD177 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CD177 antigenNB1 GP, CD177 molecule, HNA-2a, HNA2Acell surface receptor, Human neutrophil alloantigen 2a, NB1PRV-1, polycythemia rubra vera 1, Polycythemia rubra vera protein 1, PRV1NB1 glycoprotein
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CD177
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51513. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
57126
Common Name:
CD177 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CD177 antigenNB1 GP, CD177 molecule, HNA-2a, HNA2Acell surface receptor, Human neutrophil alloantigen 2a, NB1PRV-1, polycythemia rubra vera 1, Polycythemia rubra vera protein 1, PRV1NB1 glycoprotein
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CD177
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51513. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51362
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Cell division cycle 40 homolog, cell division cycle 40 homolog (S. cerevisiae), cell division cycle 40 homolog (yeast), Ehb3, EH-binding protein 3, hPRP17, MGC102802, pre-mRNA splicing factor 17, pre-mRNA-processing factor 17, PRP17 homolog, PRP17EHB3PRPF17FLJ10564
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
51362
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Cell division cycle 40 homolog, cell division cycle 40 homolog (S. cerevisiae), cell division cycle 40 homolog (yeast), Ehb3, EH-binding protein 3, hPRP17, MGC102802, pre-mRNA splicing factor 17, pre-mRNA-processing factor 17, PRP17 homolog, PRP17EHB3PRPF17FLJ10564
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__