NBP258578PE
Novus Biologicals™ wdyhv1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258578PE-Each-of-1 | In Stock | ₹ 31,372.50 |
NBP258578PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 31,372.50
GST (18%): ₹ 5,647.05
Total Price: ₹ 37,019.55
Gene ID (Entrez)
55093
Common Name
wdyhv1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
C8orf32, chromosome 8 open reading frame 32, EC 3.5.1.-, FLJ10204, nt(Q)-amidase, NTAQ1, N-terminal Gln amidase, Protein NH2-terminal glutamine deamidase, protein N-terminal glutamine amidohydrolase, WDYHV motif containing 1, WDYHV motif-containing protei
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
WDYHV1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51873. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human wdyhv1
- Source: E.coli Amino Acid Sequence: RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADS The wdyhv1 Recombinant Protein Antigen is derived from E
- coli
- The wdyhv1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 55093
Common Name: wdyhv1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C8orf32, chromosome 8 open reading frame 32, EC 3.5.1.-, FLJ10204, nt(Q)-amidase, NTAQ1, N-terminal Gln amidase, Protein NH2-terminal glutamine deamidase, protein N-terminal glutamine amidohydrolase, WDYHV motif containing 1, WDYHV motif-containing protei
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: WDYHV1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51873. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55093
Common Name:
wdyhv1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C8orf32, chromosome 8 open reading frame 32, EC 3.5.1.-, FLJ10204, nt(Q)-amidase, NTAQ1, N-terminal Gln amidase, Protein NH2-terminal glutamine deamidase, protein N-terminal glutamine amidohydrolase, WDYHV motif containing 1, WDYHV motif-containing protei
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
WDYHV1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51873. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51366
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DD5, E3 ubiquitin protein ligase, HECT domain containing, 1, E3 ubiquitin-protein ligase, HECT domain-containing 1, EC 6.3.2, EC 6.3.2.-, EDD1E3 ubiquitin-protein ligase UBR5, EDDE3 identified by differential display, hHYD, HYDFLJ11310, Hyperplastic discs protein homolog, KIAA0896MGC57263, progestin induced protein, Progestin-induced protein, ubiquitin protein ligase E3 component n-recognin 5, ubiquitin-protein ligase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
51366
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DD5, E3 ubiquitin protein ligase, HECT domain containing, 1, E3 ubiquitin-protein ligase, HECT domain-containing 1, EC 6.3.2, EC 6.3.2.-, EDD1E3 ubiquitin-protein ligase UBR5, EDDE3 identified by differential display, hHYD, HYDFLJ11310, Hyperplastic discs protein homolog, KIAA0896MGC57263, progestin induced protein, Progestin-induced protein, ubiquitin protein ligase E3 component n-recognin 5, ubiquitin-protein ligase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 84071
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: armadillo repeat containing 2, armadillo repeat-containing protein 2, bA787I22.1, DKFZp434P0714, RP11-787I22.1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
84071
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
armadillo repeat containing 2, armadillo repeat-containing protein 2, bA787I22.1, DKFZp434P0714, RP11-787I22.1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 84071
Common Name: ARMC2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: armadillo repeat containing 2, armadillo repeat-containing protein 2, bA787I22.1, DKFZp434P0714, RP11-787I22.1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ARMC2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51875. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
84071
Common Name:
ARMC2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
armadillo repeat containing 2, armadillo repeat-containing protein 2, bA787I22.1, DKFZp434P0714, RP11-787I22.1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ARMC2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51875. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml