NBP258605PE
Novus Biologicals™ MAD2L2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258605PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258605PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
10459
Common Name
MAD2L2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
hREV7, MAD2 mitotic arrest deficient-like 2 (yeast), MAD2BREV7 homolog, MAD2-like protein 2, Mitotic arrest deficient 2-like protein 2, mitotic arrest deficient homolog-like 2, mitotic spindle assembly checkpoint protein MAD2B, REV7yeast, homolog)-like 2
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MAD2L2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51112. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAD2L2
- Source: E.coli Amino Acid Sequence: SLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH The MAD2L2 Recombinant Protein Antigen is derived from E
- coli
- The MAD2L2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 10459
Common Name: MAD2L2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: hREV7, MAD2 mitotic arrest deficient-like 2 (yeast), MAD2BREV7 homolog, MAD2-like protein 2, Mitotic arrest deficient 2-like protein 2, mitotic arrest deficient homolog-like 2, mitotic spindle assembly checkpoint protein MAD2B, REV7yeast, homolog)-like 2
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MAD2L2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51112. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10459
Common Name:
MAD2L2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
hREV7, MAD2 mitotic arrest deficient-like 2 (yeast), MAD2BREV7 homolog, MAD2-like protein 2, Mitotic arrest deficient 2-like protein 2, mitotic arrest deficient homolog-like 2, mitotic spindle assembly checkpoint protein MAD2B, REV7yeast, homolog)-like 2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MAD2L2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51112. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 60558
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 3.6.5.-, EF-4, Elongation factor 4 homolog, FLJ13220, GTPase GUF1, GTPase of unknown function 1, GTP-binding protein GUF1 homolog, GUF1 GTPase homolog (S. cerevisiae), Ribosomal back-translocase, translation factor GUF1, mitochondrial
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
60558
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 3.6.5.-, EF-4, Elongation factor 4 homolog, FLJ13220, GTPase GUF1, GTPase of unknown function 1, GTP-binding protein GUF1 homolog, GUF1 GTPase homolog (S. cerevisiae), Ribosomal back-translocase, translation factor GUF1, mitochondrial
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 60558
Common Name: GUF1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 3.6.5.-, EF-4, Elongation factor 4 homolog, FLJ13220, GTPase GUF1, GTPase of unknown function 1, GTP-binding protein GUF1 homolog, GUF1 GTPase homolog (S. cerevisiae), Ribosomal back-translocase, translation factor GUF1, mitochondrial
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GUF1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49826. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
60558
Common Name:
GUF1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 3.6.5.-, EF-4, Elongation factor 4 homolog, FLJ13220, GTPase GUF1, GTPase of unknown function 1, GTP-binding protein GUF1 homolog, GUF1 GTPase homolog (S. cerevisiae), Ribosomal back-translocase, translation factor GUF1, mitochondrial
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GUF1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49826. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 94032
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: calcium/calmodulin-dependent protein kinase II inhibitor 2, CaM-KII inhibitory protein, CaM-KIIN, CAMKIIN
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
94032
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
calcium/calmodulin-dependent protein kinase II inhibitor 2, CaM-KII inhibitory protein, CaM-KIIN, CAMKIIN
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__