NBP258737PE
Novus Biologicals™ DEC2/SHARP1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258737PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258737PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
79365
Common Name
DEC2/SHARP1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
basic helix-loop-helix domain containing, class B, 3, basic helix-loop-helix family, member e41, bHLHb3, BHLHB3class E basic helix-loop-helix protein 41, bHLHe41, Class B basic helix-loop-helix protein 3, DEC2Enhancer-of-split and hairy-related protein 1,
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
BHLHE41
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52070. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEC2/SHARP1
- Source: E.coli Amino Acid Sequence: PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY The DEC2/SHARP1 Recombinant Protein Antigen is derived from E
- coli
- The DEC2/SHARP1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 79365
Common Name: DEC2/SHARP1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: basic helix-loop-helix domain containing, class B, 3, basic helix-loop-helix family, member e41, bHLHb3, BHLHB3class E basic helix-loop-helix protein 41, bHLHe41, Class B basic helix-loop-helix protein 3, DEC2Enhancer-of-split and hairy-related protein 1,
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: BHLHE41
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52070. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
79365
Common Name:
DEC2/SHARP1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
basic helix-loop-helix domain containing, class B, 3, basic helix-loop-helix family, member e41, bHLHb3, BHLHB3class E basic helix-loop-helix protein 41, bHLHe41, Class B basic helix-loop-helix protein 3, DEC2Enhancer-of-split and hairy-related protein 1,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
BHLHE41
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52070. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 4712
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: B17, CI, CI-B17, complex I, mitochondrial respiratory chain, B17 subunit, Complex I-B17, MGC13675, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, NADH-ubiquinone oxidoreductase B17 subunit, NADH-ubiquinone oxidoreductase beta subunit, 6
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4712
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
B17, CI, CI-B17, complex I, mitochondrial respiratory chain, B17 subunit, Complex I-B17, MGC13675, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, NADH-ubiquinone oxidoreductase B17 subunit, NADH-ubiquinone oxidoreductase beta subunit, 6
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 7216
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: KIAA1114, MAGE Superfamily Protein, MAGE-d3, MAGED3, MAGE-D3 Antigen, magphinin, Melanoma Antigen, Family D, 3, trophinin
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7216
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
KIAA1114, MAGE Superfamily Protein, MAGE-d3, MAGED3, MAGE-D3 Antigen, magphinin, Melanoma Antigen, Family D, 3, trophinin
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 7216
Common Name: Trophinin Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: KIAA1114, MAGE Superfamily Protein, MAGE-d3, MAGED3, MAGE-D3 Antigen, magphinin, Melanoma Antigen, Family D, 3, trophinin
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TRO
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51840. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7216
Common Name:
Trophinin Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
KIAA1114, MAGE Superfamily Protein, MAGE-d3, MAGED3, MAGE-D3 Antigen, magphinin, Melanoma Antigen, Family D, 3, trophinin
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TRO
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51840. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml