NBP258774PE
Novus Biologicals™ HSPC111 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258774PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258774PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
51491
Common Name
HSPC111 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
HBV pre-S2 trans-regulated protein 3, HSPC111HSPC185, LOC51491, NOP15, NOP16 nucleolar protein homolog (yeast), nucleolar protein 16, nucleolar protein 16 homolog, nucleolar protein 16 homolog (yeast)
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
NOP16
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50384. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPC111
- Source: E.coli Amino Acid Sequence: KGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVD The HSPC111 Recombinant Protein Antigen is derived from E
- coli
- The HSPC111 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51491
Common Name: HSPC111 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: HBV pre-S2 trans-regulated protein 3, HSPC111HSPC185, LOC51491, NOP15, NOP16 nucleolar protein homolog (yeast), nucleolar protein 16, nucleolar protein 16 homolog, nucleolar protein 16 homolog (yeast)
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NOP16
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50384. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51491
Common Name:
HSPC111 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
HBV pre-S2 trans-regulated protein 3, HSPC111HSPC185, LOC51491, NOP15, NOP16 nucleolar protein homolog (yeast), nucleolar protein 16, nucleolar protein 16 homolog, nucleolar protein 16 homolog (yeast)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NOP16
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50384. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51523
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CF5, CXXC finger 5, CXXC finger 5 protein, CXXC finger protein 5, CXXC-type zinc finger protein 5, HSPC195, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor, RINF, WID, WT1-induced Inhibitor of Dishevelled
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
51523
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CF5, CXXC finger 5, CXXC finger 5 protein, CXXC finger protein 5, CXXC-type zinc finger protein 5, HSPC195, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor, RINF, WID, WT1-induced Inhibitor of Dishevelled
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 51523
Common Name: CXXC5 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CF5, CXXC finger 5, CXXC finger 5 protein, CXXC finger protein 5, CXXC-type zinc finger protein 5, HSPC195, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor, RINF, WID, WT1-induced Inhibi
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CXXC5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50385. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51523
Common Name:
CXXC5 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CF5, CXXC finger 5, CXXC finger 5 protein, CXXC finger protein 5, CXXC-type zinc finger protein 5, HSPC195, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor, RINF, WID, WT1-induced Inhibi
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CXXC5
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50385. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 84916
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CIRHIN, cirrhosis, autosomal recessive 1A (cirhin), FLJ14728, KIAA1988FLJ17146, NAICcirhin, TEX292testis expressed gene 292
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
84916
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CIRHIN, cirrhosis, autosomal recessive 1A (cirhin), FLJ14728, KIAA1988FLJ17146, NAICcirhin, TEX292testis expressed gene 292
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__