NBP258910PE
Novus Biologicals™ Tyrosinase Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258910PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258910PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
7299
Common Name
Tyrosinase Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
CMM8, EC 1.14.18.1, LB24-AB, Monophenol monooxygenase, OCA1A, OCAIA, SHEP3, SK29-AB, Tumor rejection antigen AB, tyrosinase, tyrosinase (oculocutaneous albinism IA)
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
TYR
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51420. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Tyrosinase
- Source: E.coli Amino Acid Sequence: APIGHNRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSDPDSFQDYIKSYLEQASRI The Tyrosinase Recombinant Protein Antigen is derived from E
- coli
- The Tyrosinase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 7299
Common Name: Tyrosinase Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CMM8, EC 1.14.18.1, LB24-AB, Monophenol monooxygenase, OCA1A, OCAIA, SHEP3, SK29-AB, Tumor rejection antigen AB, tyrosinase, tyrosinase (oculocutaneous albinism IA)
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TYR
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51420. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7299
Common Name:
Tyrosinase Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CMM8, EC 1.14.18.1, LB24-AB, Monophenol monooxygenase, OCA1A, OCAIA, SHEP3, SK29-AB, Tumor rejection antigen AB, tyrosinase, tyrosinase (oculocutaneous albinism IA)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TYR
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51420. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 83874
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EBP50-PDX interactor of 64 kDa, EPI64, rab27A-GAP-alpha, TBC1 domain family member 10A, TBC1 domain family, member 10A
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
83874
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EBP50-PDX interactor of 64 kDa, EPI64, rab27A-GAP-alpha, TBC1 domain family member 10A, TBC1 domain family, member 10A
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 5332
Common Name: PLC-beta 4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 4, 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4, beta 4 (1-Phosphatidylinositol-4,5-BisphosphatePhosphodiesterase Beta 4)),
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PLCB4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51063. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5332
Common Name:
PLC-beta 4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
1-phosphatidyl-D-myo-inositol-4,5-bisphosphate, 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 4, 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4, beta 4 (1-Phosphatidylinositol-4,5-BisphosphatePhosphodiesterase Beta 4)),
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PLCB4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51063. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 662
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BCL2/adenovirus E1B 19 kDa protein-interacting protein 1, BCL2/adenovirus E1B 19kDa interacting protein 1, BCL2/adenovirus E1B 19kD-interacting protein 1, NIP1, SEC20, SEC20L, Transformation-related gene 8 protein, TRG-8, vesicle transport protein SEC20
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
662
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
BCL2/adenovirus E1B 19 kDa protein-interacting protein 1, BCL2/adenovirus E1B 19kDa interacting protein 1, BCL2/adenovirus E1B 19kD-interacting protein 1, NIP1, SEC20, SEC20L, Transformation-related gene 8 protein, TRG-8, vesicle transport protein SEC20
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__