NP269028PEP
Novus Biologicals™ BAHCC1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NP269028PEP-Each-of-1 | In Stock | ₹ 31,372.50 |
NP269028PEP - Each of 1
In Stock
Quantity
1
Base Price: ₹ 31,372.50
GST (18%): ₹ 5,647.05
Total Price: ₹ 37,019.55
Gene ID (Entrez)
57597
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Antibody Competition
Gene Symbol
BAHCC1
Quantity
100 μL
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55048. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity
>80% by SDS-PAGE and Coomassie blue staining
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
BAH and coiled-coil domain-containing protein 1, BAH domain and coiled-coil containing 1, BAH domain-containing protein 2, BAHD2, bromo adjacent homology domain-containing protein 2, FLJ23058, KIAA1447
Molecular Weight (g/mol)
27 kDa
Source
E. coli
Storage Buffer
PBS and 1M Urea, pH 7.4.
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAHCC1 Source: E.coli Amino Acid Sequence: SGLDKSGYFELPTSSQDCARPGHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQKVARIRHQQHLMAAEVEQGGIGAEAKRKSLELA
Compare Similar Items
Show Difference
Gene ID (Entrez): 57597
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: BAHCC1
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55048. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: BAH and coiled-coil domain-containing protein 1, BAH domain and coiled-coil containing 1, BAH domain-containing protein 2, BAHD2, bromo adjacent homology domain-containing protein 2, FLJ23058, KIAA1447
Molecular Weight (g/mol): 27 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.
Gene ID (Entrez):
57597
Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Antibody Competition
Gene Symbol:
BAHCC1
Quantity:
100 μL
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55048. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity:
>80% by SDS-PAGE and Coomassie blue staining
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
BAH and coiled-coil domain-containing protein 1, BAH domain and coiled-coil containing 1, BAH domain-containing protein 2, BAHD2, bromo adjacent homology domain-containing protein 2, FLJ23058, KIAA1447
Molecular Weight (g/mol):
27 kDa
Source:
E. coli
Storage Buffer:
PBS and 1M Urea, pH 7.4.
Gene ID (Entrez): 9745
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: ZNF536
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54961. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: __
Gene Alias: __
Molecular Weight (g/mol): 28 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.
Gene ID (Entrez):
9745
Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Antibody Competition
Gene Symbol:
ZNF536
Quantity:
100 μL
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54961. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity:
>80% by SDS-PAGE and Coomassie blue staining
Formulation:
__
Gene Alias:
__
Molecular Weight (g/mol):
28 kDa
Source:
E. coli
Storage Buffer:
PBS and 1M Urea, pH 7.4.
Gene ID (Entrez): 56103
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: PCDHGB2
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55065. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: __
Gene Alias: __
Molecular Weight (g/mol): 25 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.
Gene ID (Entrez):
56103
Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Antibody Competition
Gene Symbol:
PCDHGB2
Quantity:
100 μL
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55065. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity:
>80% by SDS-PAGE and Coomassie blue staining
Formulation:
__
Gene Alias:
__
Molecular Weight (g/mol):
25 kDa
Source:
E. coli
Storage Buffer:
PBS and 1M Urea, pH 7.4.
Gene ID (Entrez): 79864
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Antibody Competition
Gene Symbol: JHY
Quantity: 100 μL
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54997. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity: >80% by SDS-PAGE and Coomassie blue staining
Formulation: __
Gene Alias: __
Molecular Weight (g/mol): 26 kDa
Source: E. coli
Storage Buffer: PBS and 1M Urea, pH 7.4.
Gene ID (Entrez):
79864
Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Antibody Competition
Gene Symbol:
JHY
Quantity:
100 μL
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54997. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purity:
>80% by SDS-PAGE and Coomassie blue staining
Formulation:
__
Gene Alias:
__
Molecular Weight (g/mol):
26 kDa
Source:
E. coli
Storage Buffer:
PBS and 1M Urea, pH 7.4.