Interferon-γ human

Description

• General description: Interferon-γ (IFN-γ) is a pleotropic cytokine, encoded by the gene mapped to human chromosome 12q15.[1] It is a non-covalent homodimer with two identical 17kDa polypeptide chains. It belongs to the type II class of interferons.[2][1]
• Application: Interferon-γ human has been used in cytometric bead array to measure the levels of interferon-γ in the sample.[3]
• Biochem/physiol Actions: IFN-γ is a dimerized soluble cytokine that is the only member of the type II class of interferons.Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses.[5] IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells.[6] This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity.[6] In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.
• Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
• Physical form: Supplied as a lyophilized powder containing phosphate buffered saline.
• Analysis Note: The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay.