Recombinant full-length human PDK1 was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. PDK1 (3-phosphoinositide-dependent protein kinase) is activated by the presence of PtdIns(3,4,5)P3 or PtdIns(3,4)P2.
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
10μg Recombinant PDK1 Kinase, PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) Substrate, Reaction Buffer, DTT and MnCl2
67
PDK1 Kinase Enzyme system