Novus Biologicals™ Autophagy Antibody Pack
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB91094877-Each-of-1 | In Stock | ₹ 66,736.80 |
NB91094877 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 66,736.80
GST (18%): ₹ 12,012.624
Total Price: ₹ 78,749.424
Antigen
Autophagy
Concentration
25ul vials of each of following: NB100-2220, NB110-87318, NB110-53818, NB110-56893 and NB110-82384.
Dilution
Western Blot, Simple Western, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Knockdown Validated
Gene Alias
ATG6, ATG6 autophagy related 6 homolog, beclin 1 (coiled-coil, moesin-like BCL2 interacting protein), beclin 1 (coiled-coil, moesin-like BCL2-interacting protein), beclin 1, autophagy related, beclin1, beclin-1, Coiled-coil myosin-like BCL2-interacting protein, GT197, Protein GT197, VPS30
Immunogen
See individual datasheets
Research Discipline
Autophagy
Test Specificity
Autophagy Antibodies (Beclin, LC3, ATG5, ATG9, ATG16L1)
Target Species
Human, Mouse, Rat, Porcine, Alligator
Applications
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoassay
Conjugate
Unconjugated
Formulation
See individual datasheets
Gene Symbols
BECN1
Quantity
5 Vials
Gene ID (Entrez)
8678
Includes
1.NB100-2220: LC3B/MAP1LC3B Antibody2.NB110-53818: ATG5 Antibody3.NB110-56893: ATG9A Antibody4.NB110-82384: ATG16L1 Antibody5.NB110-87318: Beclin 1/ATG6 Antibody
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Compare Similar Items
Show Difference
Antigen: Autophagy
Concentration: 25ul vials of each of following: NB100-2220, NB110-87318, NB110-53818, NB110-56893 and NB110-82384.
Dilution: Western Blot, Simple Western, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Knockdown Validated
Gene Alias: ATG6, ATG6 autophagy related 6 homolog, beclin 1 (coiled-coil, moesin-like BCL2 interacting protein), beclin 1 (coiled-coil, moesin-like BCL2-interacting protein), beclin 1, autophagy related, beclin1, beclin-1, Coiled-coil myosin-like BCL2-interacting protein, GT197, Protein GT197, VPS30
Immunogen: See individual datasheets
Research Discipline: Autophagy
Test Specificity: Autophagy Antibodies (Beclin, LC3, ATG5, ATG9, ATG16L1)
Target Species: Human, Mouse, Rat, Porcine, Alligator
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoassay
Conjugate: Unconjugated
Formulation: See individual datasheets
Gene Symbols: BECN1
Quantity: 5 Vials
Gene ID (Entrez): 8678
Includes: 1.NB100-2220: LC3B/MAP1LC3B Antibody2.NB110-53818: ATG5 Antibody3.NB110-56893: ATG9A Antibody4.NB110-82384: ATG16L1 Antibody5.NB110-87318: Beclin 1/ATG6 Antibody
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: Beclin 1
Concentration: __
Dilution: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
Gene Alias: ATG6, ATG6 autophagy related 6 homolog, beclin 1 (coiled-coil, moesin-like BCL2 interacting protein), beclin 1 (coiled-coil, moesin-like BCL2-interacting protein), beclin 1, autophagy related, beclin1, beclin-1, Coiled-coil myosin-like BCL2-interacting protein, GT197, Protein GT197, VPS30
Immunogen: See individual datasheets
Research Discipline: Cancer, mTOR Pathway
Test Specificity: __
Target Species: Human, Mouse, Rat
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Paraffin), KnockDown
Conjugate: Unconjugated
Formulation: See individual datasheets
Gene Symbols: BECN1
Quantity: 3 Vials
Gene ID (Entrez): 8678
Includes: 1.NB110-87318: Beclin 1/ATG6 Antibody2.NB500-249: Beclin 1/ATG6 Antibody3.NB500-266: Beclin 1/ATG6 Antibody
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: Tight Junction Protein 1
Concentration: __
Dilution: Western Blot 1:1000
Gene Alias: DKFZp686M05161, MGC133289, Tight junction protein 1, tight junction protein 1 (zona occludens 1), tight junction protein ZO-1, TJP1, ZO1, ZO-1, zona occludens 1, Zona occludens protein 1, zonula occludens 1 protein, Zonula occludens protein 1
Immunogen: Synthetic peptide directed towards ZO-1 tight junction protein. Peptide sequence AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE.
Research Discipline: __
Test Specificity: __
Target Species: Rat
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS & 2% Sucrose. with No Preservative
Gene Symbols: TJP1
Quantity: 20 μL
Gene ID (Entrez): 7082
Includes: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.